Recombinant Escherichia coli Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Biochemical Function and Catalytic Mechanism

UppP dephosphorylates Und-PP to Und-P, enabling the recycling of this lipid carrier in bacterial cell wall biosynthesis. This reaction is central to both de novo synthesis and the recycling pathway, ensuring Und-P is available for polymer biosynthesis (e.g., peptidoglycan, lipopolysaccharides) .

Key Features:

  • Substrate Specificity: Targets C55-PP (undecaprenyl pyrophosphate) as the primary substrate.

  • Cofactor Dependency: Requires Mg²⁺ or Ca²⁺ ions for catalytic activity, coordinating with pyrophosphate moieties .

  • Reaction Pathway:
    Und-PP → Und-P (via hydrolysis of the terminal phosphate) .

Recombinant Production and Applications

The recombinant uppP protein is widely used in research. Key production details include:

ParameterSpecificationReference
SourceE. coli O139:H28 strain (UniProt ID: A7ZRT8).
Expression SystemE. coli C41 (DE3) with His-tag fusion for purification.
Purity>90% (SDS-PAGE).
FormLyophilized powder in Tris/PBS buffer with 6% trehalose.
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles.

Applications:

  • Enzyme Kinetics Studies: Investigating substrate specificity and cofactor requirements .

  • Antibiotic Research: Targeting UppP for novel antimicrobial therapies in pathogens like Staphylococcus aureus .

Research Findings and Mutagenesis Studies

Site-directed mutagenesis has clarified UppP’s catalytic mechanism:

MutationEffect on ActivityReference
E17A/E21AComplete loss of activity (substrate binding disrupted).
R174ANo detectable activity (pyrophosphate binding impaired).
H30ASevere reduction in catalytic efficiency.

Key Observations:

  • Mg²⁺ bridges Glu17/Glu21 and pyrophosphate, stabilizing the transition state .

  • Arg174 and Thr178 form a "P-loop" critical for substrate recognition .

Physiological and Pathological Relevance

UppP’s role extends beyond E. coli:

  • Redundancy in E. coli: PgpB, YbjG, and LpxT compensate for UppP loss, but quadruple knockouts cause cell lysis .

  • Pathogen Virulence: UppP-deficient Staphylococcus aureus and Mycobacterium tuberculosis show attenuated virulence in vivo .

  • Antibiotic Synergy: Inhibitors targeting UppP or its substrate (e.g., fosmidomycin) may restore sensitivity to β-lactams .

Table 2: Mutagenesis Outcomes ( )

ResidueRole in CatalysisActivity Impact
Glu17/Glu21Mg²⁺ coordination and pyrophosphate bindingComplete loss (E17A/E21A)
Arg174Pyrophosphate binding via hydrogen bondsNo activity (R174A)
Thr178Structural stabilization of the active siteReduced efficiency

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your requests if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. For precise delivery time information, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us beforehand as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; bacA; upk; b3057; JW3029; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
uppP
Target Protein Sequence
MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQHEGESKGRLTLIHILLGMIPAVVLGLLFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTSGDIPMFAVGFITAFVVALI AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Gene References Into Functions
  1. All the different E. coli C55-PP phosphatases identified to date (BacA and PAP2, including PgpB, YbjG and LpxT) catalyze the dephosphorylation of C55-PP molecules on the same (outer) side of the plasma membrane PMID: 26560897
  2. Multiple genes encoding membrane proteins with undecaprenyl pyrophosphate phosphatase (UppP) activity are present in Escherichia coli PMID: 15778224
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Undecaprenyl-diphosphatase (UppP) in Escherichia coli?

UppP, also known as BacA, is an integral membrane protein that plays a critical role in bacterial cell wall synthesis. It catalyzes the dephosphorylation of undecaprenyl pyrophosphate (Und-PP) to undecaprenyl phosphate (Und-P), which serves as an essential carrier lipid in peptidoglycan biosynthesis . This conversion is a crucial step in the lipid carrier cycle that supports cell wall assembly.

In E. coli, UppP accounts for approximately 75% of the total cellular Und-PP phosphatase activity . The remaining 25% of activity is distributed among three other phosphatases: PgpB, YbjG, and LpxT (formerly YeiU) . This functional redundancy highlights the critical nature of Und-P generation for bacterial survival.

What are the key structural motifs in UppP essential for enzymatic activity?

Research has identified two crucial consensus regions in UppP that are essential for its enzymatic function:

  • The (E/Q)XXXE motif - A glutamate-rich sequence that participates in catalysis

  • The PGXSRSXXT motif - Critical for substrate recognition and binding

  • A conserved histidine residue - Important for the catalytic mechanism

These motifs are proposed to be localized near the aqueous interface of UppP and oriented toward the periplasmic site, suggesting that the enzyme's biological function occurs on the outer side of the plasma membrane . Site-directed mutagenesis studies confirm the importance of these motifs, as alterations significantly affect enzyme activity.

How is recombinant UppP typically expressed and purified for research purposes?

The expression and purification protocol for recombinant UppP typically follows these methodological steps:

  • Vector Construction: The uppP gene is cloned into an expression vector with an appropriate tag (often a fusion with bacteriorhodopsin has proven effective)

  • Expression System: Transformation into E. coli C41(DE3) strain

  • Growth Conditions: Culture in LB medium containing ampicillin (100 mg/ml) at 37°C

  • Induction: Addition of 0.5 mM isopropyl β-d-thiogalactoside and 5-10 mM all-trans-retinal when A600 reaches approximately 0.9, followed by 5 hours of induction

  • Cell Harvest: Collection by centrifugation and resuspension in buffer (50 mM Tris, pH 7.5, 500 mM NaCl)

  • Membrane Isolation: Cell disruption followed by ultracentrifugation at 40,000 rpm for 1.5 hours

  • Protein Solubilization: Treatment of membrane pellet with appropriate detergent (n-dodecyl-β-D-maltoside has been successfully used)

This protocol yields recombinant UppP that can be used for activity assays and structural studies.

How can UppP enzyme activity be accurately measured in vitro?

UppP activity can be measured using a phosphate colorimetric assay as follows:

  • Reaction Mixture: 200 μl containing 50 mM HEPES (pH 7.0), 150 mM NaCl, 10 mM MgCl2, and appropriate detergent

  • Substrate Addition: Und-PP is added to initiate the reaction

  • Incubation: The reaction is incubated at optimal temperature (typically 30-37°C)

  • Phosphate Detection: Released inorganic phosphate is quantified using colorimetric reagents

  • Spectrophotometric Reading: Absorbance is measured, typically at 620-650 nm

For kinetic analysis, parameters such as Km and Vmax can be determined by varying substrate concentrations and measuring initial reaction rates.

What genetic approaches have been used to study UppP function in E. coli?

Several genetic strategies have been employed to elucidate UppP function:

  • Single Gene Knockouts: Deletion of uppP alone shows minimal effects on growth

  • Double Deletions: Mutants lacking both uppP and ybjG show increased sensitivity to cell wall-targeting antibiotics

  • Triple Deletions: Strains with deletions in uppP, ybjG, and yeiU are highly sensitive to the Und-P de novo synthesis inhibitor fosmidomycin

  • Quadruple Deletions: Complete inactivation of all four genes (uppP, pgpB, ybjG, and lpxT) is lethal, demonstrating the essential nature of this enzymatic function

  • Complementation Studies: Expressing uppP from plasmids in deletion strains to confirm functional roles

These approaches have revealed that while individual phosphatases may be dispensable, the collective activity is essential for bacterial viability.

How does recombinant UppP overexpression affect bacterial physiology?

Overexpression of recombinant UppP leads to several notable physiological changes:

  • Cell Wall Integrity: Enhanced resilience against cell wall-targeting antibiotics due to increased Und-P availability

  • Glycan Production: Potential increase in lipopolysaccharide and capsular polysaccharide synthesis

  • Growth Characteristics: Generally minimal impact on growth rate when expressed at moderate levels

  • Membrane Homeostasis: Possible membrane destabilization if Und-P levels become excessively high

  • Metabolic Burden: Energetic costs associated with overexpression of membrane proteins

The physiological impact depends significantly on expression levels and genetic background of the host strain.

What are the implications of UppP research for glycoengineering applications?

UppP research has significant implications for glycoengineering applications:

  • Enhanced Glycan Production: Engineering E. coli to maintain higher levels of Und-P can significantly increase glycan expression

  • Vaccine Development: Improved production of bacterial capsular polysaccharides for conjugate vaccines

  • Therapeutic Glycans: Enhanced synthesis of bioactive glycans for therapeutic applications

  • Diagnostic Tools: More efficient production of glycan-based diagnostic reagents

  • Synthetic Biology Applications: Integration into synthetic pathways for novel glycan production

Experimental data shows that E. coli strains engineered to increase Und-P levels (through UppP and UppS manipulation) can produce up to 7-fold more Streptococcus pneumoniae serotype 4 capsular polysaccharide than traditional expression systems .

How do UppP and other undecaprenyl phosphatases differ in structure and function?

Key differences between UppP and other undecaprenyl phosphatases include:

FeatureUppPOther Phosphatases (YbjG, YeiU, PgpB)
Sequence Motifs(E/Q)XXXE and PGXSRSXXTTypical acid phosphatase motif
Activity Contribution~75% of total cellular activity~25% collectively
Evolutionary OriginBacterial-specificShared with eukaryotic enzymes
Membrane TopologyMultiple transmembrane segmentsVaries by enzyme
Substrate SpecificityHighly specific for Und-PPGenerally broader specificity
Sensitivity to InhibitorsUnique inhibition profileDifferent inhibition characteristics

Unlike UppP, YbjG, YeiU and PgpB contain typical acid phosphatase motifs similar to those found in eukaryotic dolichyl-pyrophosphate-recycling pyrophosphatases . This suggests different evolutionary origins and potentially distinct mechanisms of action.

What approaches are used for computational modeling of UppP structure?

Computational modeling of UppP structure employs several sophisticated approaches:

  • Rosetta Membrane Ab Initio Modeling: Used to generate three-dimensional structural models of E. coli UppP

  • Lipophilicity Analysis: Assessment of residue hydrophobicity in transmembrane regions

  • Molecular Dynamics Simulations: Exploration of protein behavior in membrane environments

  • Docking Studies: Prediction of substrate and inhibitor interactions

  • Sequence-Based Topology Prediction: Identification of transmembrane segments and orientation

These computational approaches have provided valuable insights into UppP structure-function relationships, particularly regarding the periplasmic orientation of the active site and the roles of specific amino acid residues in catalysis.

What considerations are important when designing site-directed mutagenesis experiments for UppP?

When planning site-directed mutagenesis studies of UppP, researchers should consider:

Successful mutagenesis experiments have identified critical residues within the consensus motifs that are essential for UppP catalytic activity.

How can the periplasmic orientation of UppP's active site be experimentally verified?

The periplasmic orientation of UppP's active site can be verified through several experimental approaches:

  • Protease Accessibility: Limited proteolysis of spheroplasts versus intact cells to determine exposed regions

  • Chemical Labeling: Site-specific labeling of accessible residues using membrane-impermeable reagents

  • Reporter Fusions: Creation of fusion proteins with reporters that indicate topology (e.g., PhoA, GFP)

  • Epitope Mapping: Introduction of epitope tags at various positions followed by accessibility studies

  • Cysteine Scanning: Introduction of cysteine residues followed by labeling with membrane-permeable and impermeable reagents

Evidence suggests that the acid phosphatase motifs of related enzymes YbjG and YeiU face the periplasmic space, supporting the hypothesis that UppP's active site is similarly oriented .

How does UppP activity relate to antibiotic sensitivity in bacteria?

UppP activity significantly impacts bacterial antibiotic sensitivity through several mechanisms:

  • Cell Wall Synthesis: Reduced UppP activity limits Und-P availability, weakening cell wall synthesis

  • Fosmidomycin Sensitivity: Double and triple deletion mutants in uppP and related genes show supersensitivity to fosmidomycin, which inhibits Und-P de novo synthesis

  • β-lactam Antibiotics: UppP deficiency increases sensitivity to β-lactams due to compromised peptidoglycan synthesis

  • Glycopeptide Antibiotics: Altered susceptibility to antibiotics targeting cell wall precursors

  • Bacitracin Resistance: UppP overexpression can confer resistance to bacitracin, which binds Und-PP

These relationships make UppP a potential target for combination antibiotic therapy approaches and highlight its importance in bacterial survival mechanisms.

What is the relationship between UppP and UppS in undecaprenyl phosphate metabolism?

UppP and UppS (undecaprenyl pyrophosphate synthase) function in a coordinated manner in undecaprenyl phosphate metabolism:

  • Metabolic Pathway: UppS synthesizes Und-PP from isoprenoid precursors, while UppP converts Und-PP to Und-P

  • Substrate Competition: During aerobic growth, UppS competes with IspB for the isoprenoid precursors IPP and FPP

  • Coordinated Expression: Overexpression of uppS in strains with modified UppP levels can increase Und-P availability by 3-fold compared to wild-type cells

  • Engineering Applications: Co-optimization of UppS and UppP expression significantly enhances glycan production

  • Regulatory Interactions: Evidence suggests coordinated regulation to maintain appropriate Und-P/Und-PP ratios

Experimental evidence demonstrates that overexpressing uppS in cells lacking non-essential PGT/GTs (ΔPGT/GT/puppS) allows cells to maintain significantly higher Und-P levels, which directly benefits glycan synthesis pathways .

How does recombinant UppP compare functionally to native UppP?

Comparison of recombinant and native UppP reveals several important functional considerations:

ParameterNative UppPRecombinant UppP
Specific ActivityBenchmarkOften lower due to folding issues
Membrane IntegrationCompleteVariable depending on expression system
Post-translational ModificationsNative modificationsMay lack specific modifications
StabilityHigh in native environmentVariable in purified state
Substrate SpecificityHighly specificGenerally preserved but can vary
Inhibitor SensitivityBenchmarkUsually comparable
pH OptimumpH 7.0-7.5Similar to native
Temperature SensitivityModerateOften more sensitive

To maximize functional similarity, expression conditions that closely mimic the native environment and careful purification protocols that preserve protein integrity are essential.

What role does UppP play in glycan expression systems for vaccine development?

UppP plays a crucial role in glycan expression systems for vaccine development:

  • Carrier Lipid Availability: UppP activity directly affects the availability of Und-P, the essential carrier for glycan assembly

  • Capsular Polysaccharide Production: Enhanced UppP function increases the production of bacterial capsular polysaccharides used in conjugate vaccines

  • Expression Optimization: Engineering UppP and related enzymes can improve yields of vaccine-relevant glycans

  • Pneumococcal Vaccines: Recombinant Streptococcus pneumoniae capsular polysaccharide expression can be increased 7-fold in optimized E. coli systems

  • Process Scalability: UppP modifications can improve consistency and scalability of glycan production

Experimental evidence demonstrates that E. coli strains with optimized Und-P pathways (through UppP and UppS engineering) show substantially improved expression of potentially any Und-P-dependent polymer, making them valuable platforms for vaccine glycan production .

What regulatory mechanisms control UppP expression in E. coli?

UppP expression in E. coli is regulated through several mechanisms:

  • Cell Wall Stress Response: Upregulation in response to cell wall targeting antibiotics

  • Growth Phase Dependency: Expression levels vary depending on growth phase

  • Metabolic Feedback: Possible regulation based on Und-P/Und-PP ratios

  • Transcriptional Control: Specific promoter elements respond to environmental conditions

  • Post-transcriptional Regulation: Evidence for regulation at the RNA level

Understanding these regulatory mechanisms is crucial for designing expression systems that maximize recombinant UppP production and for predicting how genetic manipulations will affect cell physiology.

How can high-throughput screening methods identify UppP inhibitors?

High-throughput screening for UppP inhibitors can employ several methodological approaches:

  • Phosphate Release Assays: Colorimetric detection of inorganic phosphate released by UppP activity

  • Fluorescence-based Assays: Development of fluorescent substrates or coupled enzyme reactions

  • Cell-based Screens: Monitoring bacterial growth inhibition in UppP-dependent strains

  • Virtual Screening: Computational docking of compound libraries against UppP structural models

  • Fragment-based Approaches: Identification of small molecular fragments that bind to UppP

When designing these screens, researchers should consider:

  • The membrane-bound nature of UppP

  • The need for detergent-solubilized enzyme or reconstituted proteoliposomes

  • Appropriate controls to distinguish UppP-specific inhibition from general enzyme inhibition

  • Counter-screens against human phosphatases to identify bacteria-specific inhibitors

What challenges exist in structural characterization of UppP?

Structural characterization of UppP faces several significant challenges:

  • Membrane Protein Crystallization: Difficulties in growing high-quality crystals of membrane proteins

  • Detergent Selection: Finding detergents that maintain UppP structure while allowing crystallization

  • Protein Stability: Maintaining enzyme stability during purification and crystallization processes

  • Conformational Heterogeneity: Multiple conformational states complicating structural analysis

  • Expression Yields: Obtaining sufficient quantities of pure, properly folded protein

  • Phase Determination: Challenges in solving phase problems for membrane protein crystals

  • Dynamic Regions: Capturing catalytically important conformational changes

Despite these challenges, computational approaches like the Rosetta membrane ab initio modeling procedure have provided valuable insights into UppP structure, particularly regarding the orientation of catalytic motifs toward the periplasmic space .

How do different detergents affect recombinant UppP stability and activity?

The choice of detergent significantly impacts recombinant UppP properties:

Detergent ClassImpact on StabilityImpact on ActivityPractical Considerations
Maltosides (e.g., DDM)Generally high stabilityMaintains good activityExcellent for purification
GlucosidesModerate stabilityVariable activityLess micelle size
PhosphocholinesHigh stabilityOften maintains activityExpensive but effective
Nonionic detergentsVariable stabilityGenerally preserves activityWidely used
Zwitterionic detergentsModerate stabilityCan affect activityUseful for crystallization
Harsh detergents (SDS)Low stabilityInactivates enzymeUnsuitable for functional studies

Successful purification of active UppP has been achieved using n-dodecyl-β-D-maltoside , suggesting this as an effective detergent for maintaining both stability and activity.

What future directions are emerging in UppP research?

Emerging directions in UppP research include:

  • Structural Biology: Determination of high-resolution structures using advanced techniques like cryo-EM

  • Antibiotic Development: Design of UppP inhibitors as novel antibacterial agents

  • Glycoengineering: Further optimization of UppP and Und-P pathways for enhanced glycan production

  • Synthetic Biology: Integration of modified UppP into synthetic pathways for novel biomolecules

  • Systems Biology: Understanding UppP in the context of broader cell wall biosynthesis networks

  • Mechanism Studies: Detailed investigation of the catalytic mechanism using advanced biophysical techniques

  • Biotechnology Applications: Leveraging UppP engineering for improved production of vaccines and therapeutics

The combination of UppP and UppS engineering has already demonstrated significant potential for increasing glycan expression, suggesting that continued research in this area could yield valuable biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.