Recombinant Escherichia coli Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Stress Adaptation

UspB is a member of the RpoS (σ<sup>S</sup>) regulon, critical for stationary-phase resistance to ethanol but not heat . Key findings include:

  • Ethanol Resistance: ΔuspB mutants exhibit sensitivity to ethanol in stationary phase, implicating UspB in membrane stability under ethanol stress .

  • Overexpression Toxicity: High UspB levels induce cell death during starvation, linked to its membrane localization .

  • Regulation: Expression requires σ<sup>S</sup> and is modulated by H-NS, a nucleoid-associated protein .

3.1. Expression Systems

  • Host: E. coli strains (e.g., K12, SE11) .

  • Vectors: Moderate-copy plasmids (15–60 copies) with inducible promoters (e.g., T7, lacUV5) .

  • Secretion: UspB’s native signal peptide directs membrane localization, though recombinant versions often retain cytoplasmic inclusion bodies unless targeted .

3.2. Purification Protocols

  • Tagging: N-terminal 6×His tag facilitates nickel-affinity chromatography .

  • Yield: ~1.9 mg/g dry cell weight (DCW) in periplasm under optimized conditions .

Table 2: Production Metrics for Recombinant UspB

ParameterDetail
Optimal mediumM9 minimal medium enhances secretion vs. LB
Yield (periplasm)1.9 mg/g DCW (uspA promoter)
StabilityRequires glycerol (50%) for long-term storage at -80°C

Challenges and Future Directions

  • Toxicity: Overexpression limits high-yield production, necessitating tightly regulated promoters .

  • Membrane Localization: Solubility issues require optimization of extraction buffers and chaperone co-expression .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Please note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uspB; ECSE_3759; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli (strain SE11)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Universal Stress Protein B (uspB) and how does it function in E. coli?

Universal Stress Protein B (uspB) is one of several universal stress proteins (USPs) found in E. coli. USPs are a family of conserved proteins that help bacteria tolerate severe external stresses through regulation of the nonreplicative persistent (NRP) survival state. While the specific function of uspB has been less characterized than UspA, research indicates it likely plays a role in bacterial stress adaptation by modulating metabolic pathways during nutrient limitation, oxidative stress, and other challenging conditions. The uspB protein is upregulated under starvation, redox, toxic metals, pH, and antibiotic stresses, suggesting its broad involvement in stress response mechanisms .

How does the structure of recombinant uspB affect its functionality?

Recombinant uspB typically contains a single domain variant of approximately 14-15 kDa, consistent with the USP family architecture. The protein's functional activity depends on proper folding, which can be challenging to achieve in high-yield recombinant systems. Studies suggest that the native structure of uspB is essential for its stress protection functions, and modifications to enhance recombinant expression (such as fusion tags) must be carefully designed to avoid interfering with its tertiary structure. Successful recombinant expression strategies often involve optimization of expression conditions to ensure proper folding rather than maximizing total protein yield .

What stress conditions are known to induce uspB expression in E. coli?

The following table summarizes the main stress conditions known to induce uspB expression:

Stress TypeEffect on uspB ExpressionAssociated Metabolic Changes
Nutrient starvationStrong upregulationActivation of glyoxylate pathway
Oxidative stressModerate upregulationIncreased antioxidant response
pH stressModerate upregulationMembrane composition changes
Antibiotic exposureVariable upregulationMetabolic slowdown and NRP state
Toxic metalsModerate upregulationMetal efflux system activation

These stressors induce uspB as part of a coordinated stress response, with induction levels varying based on the severity and duration of the stress condition .

What molecular mechanisms underlie uspB's role in regulating the NRP state in E. coli?

While specific mechanisms for uspB remain under investigation, research on homologous USPs provides insights. UspA616 in Micrococcus luteus regulates the NRP state by controlling key metabolic enzymes such as malate synthase and isocitrate lyase in the glyoxylate pathway. Similarly, uspB in E. coli likely influences metabolic pathways critical for adapting to stress conditions. The protein may act as a molecular chaperone preventing protein misfolding during stress, or it might regulate gene expression by interacting with transcription factors. Recent research suggests uspB may modulate ATP levels during stress, promoting energy conservation in anticipation of prolonged nutrient limitation. Understanding these mechanisms has implications for developing strategies to combat bacterial persistence in clinical settings .

How does recombinant uspB expression affect the host E. coli metabolism?

Expression of recombinant uspB creates a significant metabolic burden on host E. coli cells. This burden manifests through multiple mechanisms:

High-level expression of recombinant uspB can overwhelm the cell's capacity, leading to growth inhibition and selection pressure for mutations that reduce expression. This has been observed when using strong promoters like the T7 system with high inducer concentrations (>0.1 mM IPTG). Interestingly, cells often respond by accumulating mutations that reduce T7 RNA polymerase activity, creating heterogeneous populations with varying production capabilities .

What are the contradictions in current research regarding uspB function?

Despite extensive research on universal stress proteins, several contradictions exist in the literature regarding uspB function:

  • Some studies suggest functional redundancy among USPs, while others indicate specific non-overlapping roles

  • The relative importance of uspB compared to other USPs (especially UspA) varies between experimental models

  • The relationship between uspB expression levels and stress tolerance shows inconsistent patterns across different stressors

  • Some data suggest uspB acts as a metabolic regulator, while others point to a role in protein quality control

These contradictions likely stem from differences in experimental conditions, genetic backgrounds, and analytical methods. The complexity of stress response networks and potential compensatory mechanisms further complicate interpretation. Resolving these contradictions requires systematic approaches with standardized experimental conditions and comprehensive measurement of multiple stress response parameters .

What are the optimal conditions for expressing recombinant uspB in E. coli?

Successful expression of functional recombinant uspB depends on carefully optimized conditions:

ParameterRecommended ConditionsRationale
Expression systemBL21(DE3) with reduced inducerBalanced expression avoiding toxic overproduction
Growth temperature18-25°C post-inductionPromotes proper folding and reduces inclusion bodies
Media compositionEnriched minimal mediaProvides resources while maintaining stress response
Induction pointMid-log phase (OD600 0.6-0.8)Cells have resources for production but aren't stressed
Inducer concentration0.05-0.1 mM IPTG for T7 systemsAvoids toxic effects of high mRNA production
Harvest timing4-6 hours post-inductionBalances yield with protein quality

These recommendations aim to avoid the metabolic burden that can trigger harmful mutations. Low inducer concentrations (below 0.1 mM IPTG) are particularly important when using T7-based expression systems to prevent toxicity effects due to excessive mRNA production .

How can researchers optimize purification strategies for recombinant uspB?

Effective purification of recombinant uspB requires consideration of its biochemical properties and expression system design:

  • Affinity tags selection: His6-tags allow efficient IMAC purification but may affect uspB function; consider cleavable tags or native purification methods if functional studies are planned

  • Solubility enhancement: Co-expression with chaperones or fusion to solubility enhancers like SUMO or MBP can improve yields of soluble protein

  • Lysis conditions: Gentle lysis methods minimize protein aggregation; sonication in short pulses with cooling intervals preserves protein integrity

  • Buffer optimization: Including reducing agents (1-5 mM DTT) and appropriate salt concentrations (typically 150-300 mM NaCl) enhances stability

  • Purification workflow: A multi-step approach combining affinity chromatography followed by size exclusion often yields best results

For functional studies, it's critical to verify that the purified protein retains its native conformation and activity through appropriate activity assays .

What analytical methods best characterize uspB structure and function?

A comprehensive characterization of recombinant uspB requires multiple complementary approaches:

  • Structural analysis:

    • Circular dichroism spectroscopy to assess secondary structure content

    • X-ray crystallography or NMR for high-resolution structural determination

    • Size exclusion chromatography to detect oligomerization states

  • Functional characterization:

    • ATP binding and hydrolysis assays (many USPs have ATP-binding domains)

    • Protein-protein interaction studies using pull-down assays or surface plasmon resonance

    • In vitro chaperone activity assays measuring prevention of protein aggregation

  • Cellular impact assessment:

    • Growth curve analysis under various stress conditions

    • Fluorescence microscopy using tagged variants to track cellular localization

    • Transcriptomic and proteomic profiling to identify affected pathways

These methods provide complementary data that, when integrated, offer insights into uspB's structural features and functional mechanisms .

How should researchers interpret contradictory results on uspB function?

Contradictory results regarding uspB function are common and may stem from several factors:

  • Genetic redundancy: E. coli contains multiple USP paralogs that may compensate for each other, masking phenotypes in single gene knockout studies

  • Strain-specific effects: Laboratory strains vary in their basal stress responses, potentially leading to different outcomes when manipulating uspB

  • Experimental conditions: The specific stressor, its intensity, and application method significantly impact results

  • Measurement timing: Acute versus chronic stress responses involve different mechanisms

To navigate these contradictions, researchers should:

  • Use multiple E. coli strains, including those with reduced USP redundancy

  • Apply a range of stressors at different intensities

  • Measure multiple endpoints at various timepoints

  • Consider combinatorial knockout approaches to address functional redundancy

  • Thoroughly document and report all experimental conditions

Robust statistical analysis using ANOVA or mixed-effects models is essential for detecting subtle phenotypes that might be obscured by variability .

What experimental approaches can differentiate uspB function from other universal stress proteins?

Differentiating uspB's specific functions from other USPs requires specialized experimental designs:

  • Genetic complementation studies: Express uspB in strains with knockouts of other USP genes to identify functional overlap or specificity

  • Domain swap experiments: Create chimeric proteins containing domains from different USPs to map functional regions

  • Temporal expression analysis: Monitor expression timing of different USPs during stress response using qRT-PCR or reporter constructs

  • Protein localization studies: Track subcellular localization of different USPs under various conditions using fluorescent fusion proteins

  • Interactome mapping: Identify protein-protein interactions specific to uspB versus other USPs using techniques like BioID or proximity labeling

A particularly effective approach involves creating E. coli strains with systematically reduced USP redundancy, similar to the Micrococcus luteus model described in the literature, which has only three USP paralogs compared to E. coli's six. This reduced redundancy simplifies observation of USP importance for stress survival .

How can artificial intelligence tools improve recombinant uspB production strategies?

Artificial intelligence approaches offer promising avenues for optimizing recombinant uspB production:

  • Machine learning models can predict optimal expression conditions based on protein sequence features

  • Neural networks can identify patterns in experimental data that reveal non-obvious relationships between culture conditions and protein yields

  • Evolutionary algorithms can design optimized expression vectors and host strain modifications

  • Natural language processing can extract insights from the scientific literature to inform experimental design

What are the most promising approaches for enhancing recombinant uspB stability and functionality?

Several innovative approaches show promise for improving recombinant uspB production:

  • Decoupling strategies: Systems like BL21-AI<gp2> that separate cell growth from recombinant protein production allow simultaneous tuning of expression rates to match cellular capacity

  • Synthetic biology approaches: Redesigned genetic circuits that respond to cellular stress by moderating uspB expression can prevent toxic accumulation

  • Chaperone co-expression systems: Tailored chaperone combinations can improve folding efficiency of recombinant uspB

  • Post-translational modification engineering: Expression systems that mimic relevant modifications found in native uspB may enhance functionality

  • Directed evolution approaches: Selection for E. coli variants with enhanced capacity for uspB production

Integration of multiple approaches, guided by systems biology understanding of host-recombinant protein interactions, offers the most comprehensive strategy for optimizing production .

How might understanding uspB function lead to new antimicrobial strategies?

Research on universal stress proteins, including uspB, reveals their central role in bacterial stress adaptation and persistence. This knowledge can inform novel antimicrobial approaches:

  • USP inhibitors could render bacteria more susceptible to conventional antibiotics by preventing adaptation to stress

  • Preventing entry into the NRP state would maintain bacterial susceptibility to antibiotics that target actively dividing cells

  • Combination therapies targeting both USP function and conventional cellular targets could reduce the development of resistance

  • Vaccines designed against USPs might prime immune responses against persistent bacterial infections

Specifically, research on UspA616 in Micrococcus luteus demonstrated that inactivation renders bacteria susceptible to stress, causing them to die instead of adapting through the NRP state. Similar approaches targeting uspB in E. coli could prove effective against persistent infections that currently resist treatment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.