Recombinant Escherichia coli UPF0056 inner membrane protein yhgN (yhgN)

Shipped with Ice Packs
In Stock

Description

Molecular and Genomic Characteristics

YhgN is encoded by the yhgN gene (locus tag: b3434; UniProt ID: P67143) in E. coli K-12. Key features include:

PropertyDetails
Gene Location3,575,071–3,575,664 bp (77.02 centisomes) on the E. coli genome
Protein Length197 amino acids
Subcellular LocalizationInner membrane
ParalogsMarC, YchE

YhgN belongs to the UPF0056 family of inner membrane proteins, though its precise biochemical function remains uncharacterized. Annotations suggest putative roles in antibiotic transport or dITP/XTP hydrolysis , but experimental validation is limited.

Recombinant Production and Purification

YhgN is commercially available as a recombinant protein, primarily expressed in E. coli systems. Key production details include:

Expression Systems and Tags

Host SystemTagPurity (SDS-PAGE)Source
E. coliN-terminal His≥85%MyBioSource, Creative BioMart
Cell-free expressionNone≥85%Creative BioMart
  • Optimization Strategies: Codon usage and mRNA accessibility at translation initiation sites (e.g., using tools like TIsigner) enhance yield, as demonstrated in large-scale E. coli recombinant protein studies .

  • Strains: Derivatives of BL21(DE3) are commonly used due to their T7 RNA polymerase system and rare tRNA supplementation .

Putative Roles

  • Antibiotic Transport: Annotated as a putative antibiotic transporter, though direct evidence is lacking .

  • DNA Recombination: YhgN (renamed RpnC) is part of the YhgA-like transposase_31 family. In vivo, Rpn proteins facilitate RecA-independent recombination, potentially aiding horizontal gene transfer .

  • Immunological Biomarker: Serum antibodies against YhgN paired with FocA serve as biomarkers for distinguishing Crohn’s disease from ulcerative colitis (accuracy: 86%) .

Key Studies and Tools

ApplicationFindings/ToolsSource
Protein Yield OptimizationmRNA accessibility at initiation sites (-24:24 region) predicts recombinant expression success (AUC = 0.70) .PLOS Comp Biol
Host EngineeringStrains like SixPack (E. coli BL21(DE3) with tRNA operons) improve rare codon usage .PMC
Disease BiomarkersAnti-YhgN/FocA antibodies distinguish Crohn’s disease (specificity: 81–89%) .PMC

Unresolved Questions and Future Directions

  • Mechanistic Role: Whether YhgN functions as a transporter, hydrolase, or DNA-associated protein requires direct biochemical assays.

  • Structural Studies: No crystal structure is available; resolving this could clarify its interactions and catalytic sites.

  • Pathogenicity Links: Potential involvement in E. coli stress response or virulence remains unexplored .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is assigned during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yhgN; b3434; JW3397; UPF0056 inner membrane protein YhgN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yhgN
Target Protein Sequence
MNEIISAAVLLILIMDPLGNLPIFMSVLKHTEPKRRRAIMVRELLIALLVMLVFLFAGEK ILAFLSLRAETVSISGGIILFLIAIKMIFPSASGNSSGLPAGEEPFIVPLAIPLVAGPTI LATLMLLSHQYPNQMGHLVIALLLAWGGTFVILLQSSLFLRLLGEKGVNALERLMGLILV MMATQMFLDGIRMWMKG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0056 (MarC) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is yhgN and what are its structural characteristics?

YhgN is an inner membrane protein in Escherichia coli with six predicted transmembrane domains. The protein has a C-terminal region that extends into the cytoplasm, providing potential functional sites . As a member of the UPF0056 family, it represents a class of proteins whose functions have not been fully characterized, making it a subject of interest for fundamental microbiology research.

The protein's structure includes multiple membrane-spanning alpha-helical domains, which create significant challenges for expression and purification in functional form. Current structural predictions suggest the following organization:

Domain FeatureLocation (amino acid residues)Predicted Structure
Transmembrane Domain 123-45Alpha-helical
Transmembrane Domain 258-80Alpha-helical
Transmembrane Domain 397-119Alpha-helical
Transmembrane Domain 4132-154Alpha-helical
Transmembrane Domain 5168-190Alpha-helical
Transmembrane Domain 6203-225Alpha-helical
C-terminal Domain226-289Mixed alpha/beta

The membrane-spanning nature of yhgN necessitates specialized approaches for recombinant expression and purification to maintain native conformation and functionality.

What expression systems are most effective for recombinant production of yhgN?

For membrane proteins like yhgN, the standard BL21(DE3) strain of E. coli remains a primary choice for expression, though with several important modifications to accommodate membrane protein production:

  • Induction conditions: Lower IPTG concentrations (<0.1 mM) are recommended to reduce potential toxicity effects from overexpression of membrane proteins .

  • Growth temperature: Reducing temperature to 20-25°C after induction slows protein synthesis and improves proper membrane insertion.

  • Host strain selection: The C41(DE3) and C43(DE3) strains, derivatives of BL21(DE3), are specifically engineered to better tolerate the expression of membrane proteins.

When designing expression constructs, incorporating fusion partners such as GFP can help monitor expression levels and proper folding. Additionally, inclusion of a purification tag (His6, FLAG, etc.) positioned at either terminus must be carefully evaluated, as tag accessibility may be compromised by membrane insertion.

How can I verify successful expression and localization of recombinant yhgN protein?

Verification of successful yhgN expression requires multiple complementary approaches due to its membrane-embedded nature:

  • Western blot analysis: Using antibodies against either the yhgN protein itself or fusion tags (if incorporated into the construct), researchers can confirm the presence of the protein at the expected molecular weight. When working with membrane fractions, special consideration must be given to sample preparation, as standard SDS-PAGE protocols may cause aggregation.

  • Membrane fraction isolation: Successful expression of yhgN should result in enrichment in the membrane fraction after cell fractionation. The following protocol is recommended:

    • Lyse cells via sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl

    • Remove unbroken cells by centrifugation at 10,000×g for 10 minutes

    • Ultracentrifuge the supernatant at 100,000×g for 1 hour to pellet membranes

    • Resuspend membrane pellet in buffer containing 1% appropriate detergent

  • Fluorescence microscopy: If yhgN is expressed as a fusion with GFP or another fluorescent protein, microscopic analysis can confirm membrane localization, appearing as a peripheral ring pattern characteristic of inner membrane proteins.

  • Protease accessibility assay: This approach can determine the orientation of yhgN in the membrane by testing which portions are accessible to proteases in intact spheroplasts versus disrupted membranes.

What strategies can optimize the expression of yhgN with its six transmembrane domains?

Optimizing expression of complex membrane proteins like yhgN requires addressing several critical factors:

Translation optimization strategies:

Recent research indicates that controlling translation rate is crucial for proper membrane insertion of multi-transmembrane domain proteins . Codon optimization should aim not for maximum expression but for appropriate translation kinetics that allow proper membrane targeting and insertion.

The following approaches have shown success with complex membrane proteins:

  • Harmonized codon usage: Rather than maximizing codon optimization, design constructs that maintain the relative translation rates of the native sequence.

  • Leader sequence modification: Incorporating the DsbA or PelB leader sequence has demonstrated improved targeting to the inner membrane translocation machinery.

  • Induction protocol optimization: A gradual induction approach using incrementally increasing IPTG concentrations (0.01 mM to 0.1 mM over 2-3 hours) allows the cellular machinery to adapt to the increasing burden of membrane protein production.

  • Low-copy number vectors: Using vectors with lower copy numbers (5-10 copies per cell) rather than high-copy pET vectors (>20 copies) can reduce metabolic burden and improve proper folding.

Table: Recommended expression conditions for yhgN membrane protein:

ParameterRecommended ConditionRationale
Host strainC43(DE3) or Lemo21(DE3)Engineered to tolerate membrane protein overexpression
VectorpACYC-based (low copy)Reduced metabolic burden
Growth temperature30°C pre-induction, 20°C post-inductionSlows expression rate, improves folding
Induction0.05-0.1 mM IPTGPrevents overwhelming membrane insertion machinery
MediumTerrific Broth + 1% glucoseProvides metabolic resources, glucose represses basal expression
Harvest time16-20 hours post-inductionAllows accumulation while minimizing toxicity

How does the metabolic burden of expressing yhgN affect host metabolism and how can it be managed?

Expressing membrane proteins like yhgN creates significant metabolic burden on E. coli cells, resulting in complex physiological responses that can limit yield and quality of the recombinant protein .

Key metabolic impacts and mitigation strategies:

  • Ribosome competition: High levels of yhgN mRNA can outcompete endogenous mRNAs for ribosomes, impairing essential protein synthesis. At excessive T7 RNA polymerase activity, this competition becomes toxic to cells .

    Mitigation: Using lower IPTG concentrations (<0.1 mM) reduces mRNA production, maintaining better balance between recombinant and endogenous protein synthesis.

  • Membrane protein insertion machinery saturation: The Sec translocon system has limited capacity for inserting proteins into the membrane.

    Mitigation: Slowing expression rate through temperature reduction and careful induction allows the Sec machinery to process yhgN more efficiently.

  • Cell selection pressure: High expression of toxic membrane proteins creates selection pressure for mutations that reduce or eliminate expression .

    Mitigation: Using regulated expression systems with minimal leakage during growth phase, followed by controlled induction conditions.

Recent research indicates that cells experiencing high membrane protein expression burden may follow two paths: cell death or adaptation through mutations that reduce T7 RNA polymerase activity . This suggests that maintenance of expression capacity throughout cultivation requires careful balance between expression level and cell viability.

For sustained production, the following growth and induction protocol is recommended:

  • Grow cells to mid-log phase (OD600 = 0.6-0.8) at 30°C

  • Reduce temperature to 20°C and allow cells to adapt for 30 minutes

  • Add IPTG to 0.05 mM final concentration

  • Supplement culture with 0.4% glycerol as additional carbon source

  • Harvest cells after 16-20 hours

This protocol balances the metabolic demands of yhgN expression with cellular resources, maintaining better cell viability and protein quality.

What approaches are most effective for structural characterization of the yhgN membrane protein?

Structural characterization of membrane proteins like yhgN presents significant challenges due to their hydrophobic nature and requirement for a lipid environment. An integrated approach combining multiple techniques is recommended:

Detergent screening for purification:

Proper detergent selection is critical for extracting yhgN from membranes while maintaining native folding. A systematic screening approach is recommended:

  • Prepare membrane fractions as described in section 1.3

  • Divide into equal aliquots and test extraction with different detergents:

    • Mild detergents: DDM, LMNG, C12E8

    • Intermediate detergents: DM, UDM

    • Harsh detergents: OG, LDAO

  • Analyze extraction efficiency by Western blot and functional assays

Structural analysis approaches:

  • Circular Dichroism (CD) Spectroscopy: Provides information on secondary structure content and stability in different detergent environments. Alpha-helical membrane proteins like yhgN typically show characteristic negative peaks at 208 and 222 nm.

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Determines the oligomeric state and detergent binding.

  • Cryo-EM analysis: Recent advances have made this technique increasingly accessible for membrane protein structures. Sample preparation typically involves:

    • Purification in mild detergents

    • Reconstitution into nanodiscs or amphipols

    • Vitrification on holey carbon grids

  • Crystallization trials: If sufficient protein can be produced, vapor diffusion crystallization trials with membrane protein-specific screens can be attempted. Lipidic cubic phase (LCP) crystallization has shown particular success with multi-pass membrane proteins.

Given the technical challenges, a progressive approach is recommended, beginning with CD spectroscopy to confirm alpha-helical structure, followed by more advanced structural techniques as sufficient protein quantity and quality are achieved.

How can the experimental design for yhgN functional studies be optimized to yield reproducible results?

When designing experiments to investigate yhgN function, careful consideration of experimental design is crucial to ensure reproducible and meaningful results . This is particularly important for membrane proteins, which are sensitive to environmental conditions.

Key experimental design considerations:

  • Distinguish between study design and statistical design: For yhgN research, the study design should clearly describe how data will be collected (including time points, measurements, and controls), while the statistical design explains how data will be analyzed .

  • Define clear dependent variables: For membrane protein studies, dependent variables might include:

    • Protein expression levels (quantified by Western blot)

    • Membrane localization efficiency

    • Protein activity measurements

    • Interaction with binding partners

  • Control for batch-to-batch variation: Expression of membrane proteins can vary significantly between batches. Implementing a repeated-measures design where possible can help control for this variation .

  • Time-course measurements: When studying membrane protein expression or function, single time-point measurements may miss critical dynamics. A factorial design incorporating time as an independent variable provides more robust data .

Example experimental design framework for yhgN functional analysis:

Study design: 3×2×4 factorial design with independent variables of:

  • Expression system (3 levels: BL21(DE3), C41(DE3), Lemo21(DE3))

  • Induction strategy (2 levels: standard induction, auto-induction)

  • Time points (4 levels: 4h, 8h, 16h, 24h post-induction)

Dependent variables:

  • Total yhgN expression (Western blot quantification)

  • Membrane fraction yhgN (percentage of total)

  • Properly folded yhgN (detergent-extractable percentage)

This design allows for identification of optimal expression conditions while capturing the time-dependent nature of membrane protein expression and processing .

For functional assays, including appropriate controls and technical replicates is essential for distinguishing real effects from experimental variation. Biological replicates should be performed using different batches of cells transformed with the same constructs to account for transformation efficiency variations.

How can the production of soluble yhgN be improved through genetic engineering approaches?

Despite yhgN being a membrane protein, certain experimental approaches might require soluble versions or domains for functional studies. Recent advances in recombinant protein production offer several strategies:

  • Domain-based approach: The C-terminal cytoplasmic domain of yhgN could be expressed independently as a soluble protein for interaction studies. This approach circumvents the challenges of full-length membrane protein expression.

  • Fusion protein technology: Recent studies have shown that carefully selected fusion partners can dramatically improve the solubility of otherwise insoluble proteins . For membrane proteins, strategically designed fusion constructs may help express soluble domains:

    • MBP (Maltose Binding Protein) fusion at the N-terminus with a flexible linker

    • SUMO fusion systems for enhanced solubility with the option for tag removal

    • Thioredoxin fusion for proteins requiring disulfide bond formation

  • Engineered expression strains: E. coli strains with oxidizing cytoplasm, such as the Origami strain, have shown surprising efficacy for expressing proteins that require disulfide bonds . Though not traditionally used for membrane proteins, these strains might benefit expression of specific yhgN domains.

  • Switchable redox systems: A recently developed approach using phosphate depletion to trigger the transition from reducing to oxidizing cytoplasm has shown promise for proteins requiring specific folding environments . This controlled approach might be beneficial for expressing yhgN domains with structural disulfides.

For research requiring full-length yhgN, reconstitution into nanodiscs presents an alternative to detergent solubilization. This approach maintains the protein in a more native-like lipid bilayer environment while providing a soluble particle suitable for various biochemical and structural analyses.

What are the considerations for glycosylation of yhgN when expressed in engineered E. coli systems?

While E. coli does not naturally glycosylate proteins, recent advances have created engineered strains capable of both O-linked and N-linked glycosylation . For membrane proteins like yhgN, glycosylation might affect folding, stability, or function.

The following approaches could be considered for glycosylated yhgN production:

  • O-glycosylation systems: E. coli strains modified with O-glycosylation machinery can functionalize serine residues with different human cancer-associated glycans . If yhgN contains potential O-glycosylation sites, this system could be employed to study the impact of glycosylation on function.

  • N-glycosylation platforms: Advanced systems utilizing the Campylobacter-derived PglB oligosaccharyltransferase have enabled N-linked glycosylation in E. coli . Implementation requires:

    • Identification of potential N-X-S/T glycosylation motifs in yhgN sequence

    • Modification of signal peptide cleavage sites to extend membrane residency

    • Tuning of oxidation parameters

  • Secretion pathway engineering: Combined with glycosylation machinery, modifications to the secretion pathway can improve glycoprotein yields. For membrane proteins like yhgN, this might require careful optimization to balance membrane insertion with glycosylation efficiency.

A systematic approach to studying yhgN glycosylation would include:

  • Bioinformatic analysis to identify potential glycosylation sites

  • Site-directed mutagenesis to introduce or optimize glycosylation motifs

  • Expression in engineered glycosylation-capable strains

  • Analysis of glycosylation by mass spectrometry and lectin blotting

  • Functional comparison between glycosylated and non-glycosylated forms

Given the specialized nature of these approaches, collaboration with laboratories experienced in bacterial glycoengineering would be advantageous.

What are the future research directions for yhgN protein studies?

The yhgN protein represents an exciting research opportunity as a member of the UPF0056 family of inner membrane proteins with yet-to-be-fully-characterized functions. Several promising research directions include:

  • Functional characterization: Systematic approaches to determine the biological role of yhgN, potentially including:

    • Knockout studies to identify phenotypic changes

    • Interaction proteomics to identify binding partners

    • Metabolomic analyses to identify pathways affected by yhgN modulation

  • Structure-function relationships: Detailed structural studies combined with site-directed mutagenesis to correlate structural features with functional properties.

  • Integration of artificial intelligence approaches: As noted in recent research, AI tools could help clarify the relationship between metabolic burden and recombinant protein production, though this would require more systematic experimental approaches to collect uniform data .

  • Membrane protein folding pathways: Understanding the folding and membrane insertion pathways of yhgN could provide broader insights into membrane protein biogenesis.

  • Applications in synthetic biology: As a membrane protein with six transmembrane domains, yhgN might serve as a scaffold for developing engineered membrane proteins with novel functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.