Recombinant Escherichia coli UPF0059 membrane protein yebN (yebN)

Shipped with Ice Packs
In Stock

Description

Introduction to Escherichia coli Membrane Proteins

Escherichia coli serves as one of the most extensively studied model organisms in molecular biology, offering valuable insights into bacterial physiology and genetics. As a Gram-negative bacterium, E. coli possesses a complex cell envelope consisting of an inner cytoplasmic membrane, a periplasmic space containing peptidoglycan, and an outer membrane with a unique asymmetric lipid distribution. This outer membrane contains lipopolysaccharides (LPSs) on its external surface and phospholipids (PLs) on its inner surface, creating a protective barrier that contributes significantly to bacterial survival and antibiotic resistance .

Membrane proteins in E. coli perform numerous essential functions, including nutrient transport, signal transduction, energy generation, and maintenance of membrane integrity. These proteins can be categorized based on their topology, function, or evolutionary relationships. The UPF (Uncharacterized Protein Family) designation, such as UPF0059 for YebN, indicates proteins with conserved sequences across species but whose precise functions remain to be fully elucidated.

Membrane Protein Biogenesis and Assembly

The biogenesis and assembly of membrane proteins in E. coli involve complex processes of synthesis, folding, and insertion into the appropriate membrane. Nearly all membrane proteins are synthesized and assembled at specialized cellular locations, similar to the endoplasmic reticulum (ER) in eukaryotic cells, which serves as the primary site for membrane protein production . This process requires precise mechanisms to ensure correct orientation and folding of transmembrane segments.

Maintenance of Membrane Asymmetry

The maintenance of membrane asymmetry is crucial for Gram-negative bacteria like E. coli. The Mla (Maintenance of Outer Membrane Lipid Asymmetry) pathway plays a significant role in this process. Understanding membrane protein function within this context provides valuable insights into bacterial physiology and potential antimicrobial targets .

YebN: An UPF0059 Membrane Protein

The YebN protein belongs to the UPF0059 family of membrane proteins. While sharing structural similarities with other membrane transport proteins, YebN possesses unique characteristics that distinguish it from better-characterized membrane proteins such as YebT, which functions as a lipid transporter spanning between the inner membrane (IM) and outer membrane (OM) .

Evolutionary Conservation

The classification of YebN within the UPF0059 family indicates evolutionary conservation across multiple bacterial species, suggesting an important functional role that has been preserved throughout bacterial evolution. This conservation provides valuable clues for understanding its potential physiological significance in E. coli and related organisms.

Recombinant Expression Systems for YebN

The expression of recombinant membrane proteins presents unique challenges due to their hydrophobic nature and requirements for proper membrane insertion. E. coli-based expression systems have been specifically developed to address these challenges, with specialized strains offering advantages for membrane protein production.

coli Expression Strains

E. coli expression strains such as BL21(DE3) and DL39 serve as powerful tools for recombinant protein production, each offering distinct advantages for membrane protein expression .

Table 1: Key Features of E. coli Expression Strains for Membrane Protein Production

FeatureBL21(DE3)DL39
Genetic SystemT7 RNA polymerase under lacUV5 promoterSimilar T7 expression system
Proteolytic ActivityLacks Lon and OmpT proteasesReduced proteolytic degradation
Growth CharacteristicsRapid growth, high cell densityRapid growth typical of E. coli strains
Special FeaturesHigh transcription rate from T7 promoterAuxotrophic background useful for specific amino acid incorporation
Transformation EfficiencyHigh efficiency for plasmid uptakeHigh transformation efficiency
ApplicationsGeneral recombinant protein expressionSpecialized applications requiring auxotrophy

BL21(DE3), a commonly used expression strain, contains the T7 RNA polymerase gene controlled by the lacUV5 promoter, allowing for inducible expression when IPTG (Isopropyl β-D-1-thiogalactopyranoside) is added to the culture. This system enables high-level production of recombinant proteins, with transcription rates approximately 5-10 times higher than those achieved with E. coli's native RNA polymerase .

The absence of Lon and OmpT proteases in BL21(DE3) further enhances its utility for recombinant protein production by reducing proteolytic degradation of the expressed proteins. This feature is particularly valuable for membrane proteins, which may be more susceptible to degradation during expression and purification .

Expression Vector Design for YebN

For effective expression of membrane proteins like YebN, vector design plays a crucial role. The incorporation of appropriate promoters, ribosome binding sites, fusion tags, and termination sequences influences expression levels and protein solubility. Vectors containing the T7 promoter are particularly valuable for membrane protein expression, as they enable tight regulation and high-level induction when used with compatible strains like BL21(DE3) .

Optimization Strategies for YebN Expression

Successful expression of membrane proteins requires optimization of numerous parameters:

  1. Temperature modulation to balance expression rate with proper folding

  2. Inducer concentration optimization to control expression levels

  3. Growth media formulation to support membrane protein integration

  4. Co-expression with chaperones to facilitate proper folding

  5. Fusion tag selection to enhance solubility and purification efficiency

Functional Characterization

Functional characterization of membrane proteins typically involves:

  1. Gene knockout studies to assess physiological impact

  2. Complementation assays to confirm functional roles

  3. Transport assays to identify substrates and kinetics

  4. Protein-protein interaction studies to map cellular pathways

  5. Localization studies to determine subcellular distribution

Recent research on uncharacterized proteins in E. coli has employed high-throughput methods to characterize transcription factors, classifying them into different regulatory groups based on their target genes and binding properties . Similar approaches could potentially be applied to membrane proteins like YebN to elucidate their functional roles.

Research Applications of Recombinant YebN

The study of membrane proteins like YebN has implications across multiple research fields and applications.

Biotechnological Applications

Recombinant E. coli strains have proven valuable for various biotechnological applications. For example, engineered E. coli expressing specific enzymes has been developed for environmental bioremediation, demonstrating efficient degradation of trichloroethylene (TCE) to carbon dioxide, chloride ions, and simple water-soluble metabolites . Similar approaches utilizing membrane proteins could potentially address challenges in bioremediation, biosensing, or bioproduction.

Antimicrobial Development

Bacterial membrane proteins often serve as targets for antimicrobial agents. The unique structure and essential functions of these proteins make them attractive candidates for drug development. Understanding the structure and function of YebN could potentially reveal new targets for antimicrobial development, addressing the growing challenge of antibiotic resistance in Gram-negative bacteria.

Table 3: Comparison of E. coli Membrane Transport Systems

Transport SystemComponentsFunctionRelevance to YebN Research
Mla PathwayMlaA, MlaB, MlaC, MlaD, MlaE, MlaFMaintenance of outer membrane lipid asymmetryProvides context for potential YebN function in membrane homeostasis
Lipid TransportYebT (MlaD homolog)Lipid transport between inner and outer membranesStructural and functional comparison model
Ion TransportVarious transportersMovement of ions across membranesPotential functional category for YebN
Nutrient TransportSpecific transportersUptake of nutrients from environmentPossible functional role of YebN
Drug EffluxMulti-component systemsRemoval of toxic compoundsPotential involvement in antibiotic resistance

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; yebN; ECDH10B_1959; Probable manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Escherichia coli (strain K12 / DH10B)
Target Names
mntP
Target Protein Sequence
MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0059 membrane protein yebN and what is its function in E. coli?

YebN, also known as MntP, is a membrane protein in Escherichia coli that functions as a probable manganese efflux pump. This 188-amino acid protein belongs to the UPF0059 family of membrane proteins and plays a crucial role in metal homeostasis within bacterial cells . The protein is involved in the transport of manganese ions across the cell membrane, helping to maintain appropriate intracellular concentrations of this essential but potentially toxic metal.

What are the alternative designations for the yebN protein in scientific literature?

Based on available research data, yebN is also known by several alternative designations:

Alternative NameDescriptionDatabase Identifier
mntPProbable manganese efflux pump MntPGene name
UTI89_C2019Strain-specific identifierGenome annotation
UPF0059 membrane proteinFamily designationProtein family classification
Q1RAW9UniProt identifier for E. coli variantUniProt ID
Q7UCL3Alternative UniProt IDUniProt ID

Understanding these alternative designations is essential for comprehensive literature searches and database queries in yebN research .

What expression systems are most suitable for recombinant production of yebN protein?

  • Expression vectors with inducible promoters (such as T7) provide better control over protein expression timing and levels.

  • Host strain selection is critical—E. coli strains engineered for membrane protein expression (e.g., C41/C43 or Lemo21) may yield better results.

  • Fusion tags, particularly His-tags, facilitate downstream purification while minimally impacting protein structure.

For challenging membrane proteins like yebN, specialized systems such as E. coli Lemo21(DE3) have shown improved expression by allowing fine-tuning of expression levels, similar to what was observed with other membrane proteins .

How can researchers optimize the expression of membrane proteins like yebN in E. coli?

Optimizing expression of membrane proteins like yebN requires a multifaceted approach addressing several key parameters:

  • N-terminal modifications and signal peptides: Testing different N-terminal modifications or signal peptides (such as ompA) can significantly improve membrane insertion and protein folding .

  • Expression vector selection: Vectors with tightly controlled promoters prevent premature expression that can lead to toxicity.

  • Induction conditions: Lower induction temperatures (16-25°C) and reduced inducer concentrations often improve proper folding of membrane proteins.

  • Growth media optimization: Supplementation with specific ions or cofactors relevant to protein function can enhance expression yields.

  • Host strain selection: As demonstrated with CYP450s, E. coli Lemo21(DE3) can effectively improve the expression of membrane proteins in the plasma membrane .

It's worth noting that a brick-red appearance of bacterial cultures or membrane fractions, which is sometimes observed during expression attempts, doesn't necessarily indicate successful overexpression of target membrane proteins and should be verified through additional analytical methods .

What purification methods are effective for recombinant yebN protein?

Purification of recombinant yebN protein typically follows established protocols for membrane proteins with affinity tags:

  • Cell lysis and membrane isolation: Gentle cell disruption methods (sonication or French press) followed by differential centrifugation to isolate membrane fractions.

  • Membrane solubilization: Selection of appropriate detergents is critical—mild non-ionic detergents (DDM, LMNG, or C12E8) that maintain protein structure while effectively solubilizing membranes.

  • Affinity chromatography: His-tagged yebN can be purified using Ni-NTA or IMAC chromatography, with careful optimization of imidazole concentrations in washing and elution buffers .

  • Size exclusion chromatography: As a polishing step to remove aggregates and ensure monodispersity of the purified protein.

  • Quality control: SEC-MALS, SDS-PAGE, and functional assays to verify protein purity, homogeneity, and activity.

For storage, lyophilization in appropriate buffer systems containing stabilizers like trehalose has been shown to preserve protein integrity, as noted in the available product information .

How can researchers assess the proper folding and functionality of recombinantly expressed yebN?

Assessment of proper folding and functionality of recombinant yebN should incorporate multiple complementary approaches:

  • Thermal stability assays: Techniques like differential scanning fluorimetry (DSF) or nanoDSF to evaluate protein stability and detect properly folded conformations.

  • Circular dichroism (CD) spectroscopy: To analyze secondary structure content and compare with predicted structural elements.

  • Functional transport assays: Development of in vitro or in vivo assays to measure manganese transport activity, the presumed function of yebN/MntP.

  • Ligand binding studies: Isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to characterize binding of manganese or other potential substrates.

  • Membrane incorporation assessment: Fluorescence-based approaches to verify proper membrane insertion, similar to methods used for other membrane proteins .

Importantly, researchers should include appropriate positive and negative controls in all functional assays to ensure reliable interpretation of results.

What challenges are associated with studying membrane proteins like yebN compared to soluble proteins?

Membrane proteins like yebN present several distinct challenges compared to soluble proteins:

  • Expression limitations: Overexpression often leads to toxicity, protein misfolding, or formation of inclusion bodies due to cellular membrane capacity limitations.

  • Detergent requirements: The need for detergents throughout purification and characterization introduces variables that can affect protein stability and function.

  • Structural heterogeneity: Membrane proteins often exist in multiple conformational states, complicating structural studies.

  • Lipid environment dependency: Function and stability are frequently dependent on specific lipid environments that are difficult to replicate in vitro.

  • Reconstitution complexity: Transferring purified membrane proteins into artificial membrane systems while maintaining native orientation and functionality requires optimization of multiple parameters .

These challenges necessitate specialized approaches and careful experimental design when working with yebN and other membrane proteins.

How can the orientation and mobility of yebN be preserved in experimental systems?

Preserving the native orientation and mobility of membrane proteins like yebN in experimental systems requires careful consideration of the membrane environment:

  • Supported lipid bilayers: A method using cell blebs as intermediates can transfer membrane proteins to supported lipid bilayers while preserving both orientation and mobility. This approach has shown over 50% mobility for multipass transmembrane proteins and over 90% for GPI-linked proteins .

  • Verification of orientation: Enzymatic assays can confirm that the extracellular domains face toward the bulk solution, ensuring physiologically relevant orientation .

  • Single molecule tracking: Advanced techniques like single molecule tracking and moment scaling spectrum (MSS) analysis can characterize protein diffusion in supported bilayers, revealing details of protein mobility and lipid membrane heterogeneity .

  • Bleb-based bilayer formation: This technique offers advantages over proteoliposome reconstitution or disrupted cell membrane preparations, which typically result in significant scrambling of protein orientation and immobilized membrane proteins .

By maintaining the native lipid environment and correct orientation, these approaches provide more physiologically relevant systems for studying membrane proteins like yebN.

What statistical approaches should be applied to validate experimental results with yebN protein?

Proper statistical validation of experimental results with yebN protein should follow evidence-based statistical analysis practices:

  • Study design reporting: Clear description of experimental design features that influence the choice of statistical analysis, including sample size determination, randomization procedures, and blinding methods where applicable .

  • Appropriate statistical methods: Selection of statistical tests based on data distribution, sample size, and experimental design. For example, parametric tests require normal distribution assumptions, while non-parametric alternatives may be more appropriate for non-normally distributed data .

  • Multivariable analysis: Inclusion of factors that might confound, interact with, or predict experimental outcomes, particularly important in complex systems involving membrane proteins .

  • Model validation: Assessment of assumptions, stability, and robustness of multivariable models through techniques like sensitivity analysis or cross-validation .

  • Reproducibility measures: Reporting confidence intervals, predictive intervals, and measures of internal and external validity to ensure reproducibility of findings .

Additionally, researchers should adjust for multiplicity when multiple outcomes or comparisons are analyzed, and provide sufficient methodological detail to allow reproduction of the analytical approach .

What advanced techniques are available for studying yebN-lipid interactions?

Understanding yebN-lipid interactions requires sophisticated biophysical and biochemical approaches:

  • Native mass spectrometry: Enables detection of specifically bound lipids that may be essential for protein function or stability.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies protein regions with altered solvent accessibility in different lipid environments.

  • Molecular dynamics simulations: Provides atomic-level insights into protein-lipid interactions and their effects on protein conformation and dynamics.

  • Fluorescence correlation spectroscopy (FCS): Measures diffusion properties in different lipid environments to understand how lipid composition affects protein behavior.

  • Cryo-electron microscopy: Visualizes protein structure in membrane environments, potentially revealing lipid binding sites and their structural consequences.

These approaches can be integrated to develop a comprehensive understanding of how specific lipids interact with yebN and influence its structure, dynamics, and function.

How can researchers address the challenges of recombinant expression for difficult-to-express membrane proteins like yebN?

For challenging membrane proteins similar to yebN, researchers can implement several advanced strategies:

  • Fusion partners optimization: Testing multiple fusion partners beyond simple affinity tags, including maltose-binding protein (MBP), thioredoxin, or SUMO, which can enhance solubility and proper folding.

  • Codon optimization: Adjusting codon usage to match the expression host while avoiding rare codons that may cause translational pauses and misfolding.

  • Chaperone co-expression: Co-expressing molecular chaperones like GroEL/GroES or DnaK/DnaJ/GrpE systems to assist in proper protein folding.

  • Cell-free expression systems: Bypassing cellular toxicity issues through cell-free protein synthesis systems that can accommodate membrane proteins by incorporating nanodiscs or liposomes.

  • N-terminal modifications: As demonstrated with CYP450s, specific N-terminal modifications and signal peptides can dramatically improve expression levels and membrane targeting .

Systematic screening approaches, testing multiple conditions and expression systems in parallel, have proven effective for other difficult-to-express membrane proteins and could be adapted for yebN research .

What emerging technologies might advance our understanding of yebN protein structure and function?

Several cutting-edge technologies show promise for advancing yebN research:

  • AlphaFold and other AI-based structure prediction: These approaches may provide initial structural models to guide experimental design, especially for membrane proteins that resist traditional structural determination.

  • CryoEM methodologies: Advances in sample preparation and image processing have made structural determination of smaller membrane proteins increasingly feasible.

  • Native nanodiscs: These systems provide a more native-like lipid environment than detergent micelles while maintaining sample homogeneity required for structural studies.

  • Genetically encoded sensors: Development of biosensors for detecting manganese transport could enable real-time monitoring of yebN function in living cells.

  • Integrative structural biology: Combining multiple experimental and computational approaches to develop comprehensive structural and functional models of membrane proteins in their native environments.

These technologies, when applied systematically to yebN research, could significantly enhance our understanding of this membrane protein's structure, function, and physiological role.

How can researchers effectively troubleshoot expression and purification issues specific to yebN?

Effective troubleshooting of yebN expression and purification requires systematic investigation of potential issues:

  • Expression verification: Beyond relying on visual cues like culture coloration, use Western blotting with anti-His antibodies to verify expression, as brick-red appearance of cultures doesn't necessarily indicate successful expression .

  • Solubilization screening: If membrane fraction isolation yields protein but subsequent solubilization is poor, conduct detergent screening using high-throughput approaches to identify optimal solubilization conditions.

  • Stability assessment: Monitor protein stability throughout purification using techniques like SEC-MALS or dynamic light scattering to identify steps where aggregation or degradation occurs.

  • Buffer optimization: Systematically test buffers varying in pH, ionic strength, and specific ions (particularly manganese) that might stabilize the protein.

  • Storage condition evaluation: If purified protein loses activity during storage, test various additives (glycerol, trehalose, specific lipids) and storage conditions (temperature, concentration) to maintain functionality .

Maintaining detailed records of all optimization attempts and results facilitates the identification of patterns that may reveal underlying issues affecting yebN production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.