Recombinant Escherichia coli UPF0070 protein yfgM (yfgM)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yfgM; b2513; JW2497; Ancillary SecYEG translocon subunit; Periplasmic chaperone YfgM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yfgM
Target Protein Sequence
MEIYENENDQVEAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNA VTAVSEGKPDSIPAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTSD ENLKAVINLRLARVQVQLKQADAALKTLDTIKGEGWAAIVADLRGEALLSKGDKQGARSA WEAGVKSDVTPALSEMMQMKINNLSI
Uniprot No.

Target Background

Function
YfgM, a membrane-associated protein, may facilitate protein transfer from the SecYEG translocon to the periplasmic chaperone network via its periplasmic C-terminal domain. Furthermore, at the cytosolic site, it acts as a negative regulator of RcsB. During stationary phase, FtsH-dependent degradation of YfgM releases RcsB, activating the Rcs phosphorelay system for cellular protection. YfgM may also coordinate stress responses across the inner membrane through a dynamic protein-protein interaction network within and outside the membrane.
Gene References Into Functions
  1. The identification of HdeB and other cell envelope proteins as potential substrates for the periplasmic chaperone YfgM. PMID: 25403562
Database Links
Protein Families
UPF0070 family
Subcellular Location
Cell inner membrane; Single-pass type II membrane protein; Periplasmic side.

Q&A

What is the functional role of YfgM in E. coli?

YfgM functions as an ancillary subunit of the Sec translocon in E. coli, playing a critical role in protein secretion—a process essential for both cell viability and pathogenesis in Gram-negative bacteria . The Sec translocon serves as the primary conduit for proteins exiting the cytoplasm, with YfgM joining other ancillary modules such as SecA, SecDF-YajC, YidC, and PpiD in facilitating this process.

Phenotypic analyses of strains lacking the yfgM gene suggest that its physiological role overlaps functionally with periplasmic chaperones SurA and Skp . The current model proposes that YfgM mediates the trafficking of proteins from the Sec translocon to the periplasmic chaperone network that contains SurA, Skp, DegP, PpiD, and FkpA, ensuring proper folding and processing of secreted proteins .

To investigate YfgM function experimentally:

  • Create yfgM knockout strains and assess growth phenotypes under various conditions

  • Perform complementation studies with wild-type and mutant YfgM variants

  • Monitor secretion efficiency of model substrate proteins in yfgM mutants

  • Use fluorescently tagged YfgM to track its localization and dynamics during protein secretion

How does YfgM interact with the SecYEG translocon and other components?

YfgM has been demonstrated to interact with both the SecYEG translocon core and the periplasmic chaperone PpiD through co-immunoprecipitation and blue native/SDS-PAGE analyses . This positions YfgM at the interface between the membrane-embedded translocation channel and the periplasmic folding machinery.

The interaction network can be mapped using the following methodological approaches:

  • Pull-down assays: Using tagged YfgM to identify interaction partners through mass spectrometry

  • Cross-linking experiments: To capture transient protein-protein interactions

  • Two-hybrid systems: For mapping binary interactions

  • Blue native PAGE: To preserve native protein complexes for analysis

Interaction PartnerDetection MethodFunctional Significance
SecYEG transloconCo-immunoprecipitation, Blue native/SDS-PAGECore protein secretion machinery
PpiDCo-immunoprecipitation, Blue native/SDS-PAGEPeriplasmic peptidyl-prolyl isomerase
SurA, Skp (functional overlap)Phenotypic analysis of deletion strainsPeriplasmic chaperones

Researchers should design experiments that distinguish between stable and transient interactions, as YfgM may participate in dynamic complexes during different stages of protein secretion and folding .

What experimental design approaches optimize recombinant YfgM expression in E. coli?

Expressing recombinant YfgM requires careful optimization of experimental conditions to ensure proper folding and functionality. Based on established protocols for recombinant protein expression in E. coli, the following factorial design approach is recommended :

Optimized expression conditions for recombinant YfgM:

  • Growth medium composition:

    • 5 g/L yeast extract

    • 5 g/L tryptone

    • 10 g/L NaCl

    • 1 g/L glucose

    • 30 μg/mL kanamycin (or appropriate selection antibiotic)

  • Induction parameters:

    • Grow culture to OD600 of 0.8

    • Induce with 0.1 mM IPTG

    • Incubate for 4 hours at 25°C

This approach is based on factorial design methodology that systematically evaluates the effects of multiple variables on protein expression . For membrane-associated proteins like YfgM, temperature reduction during induction is particularly crucial to prevent aggregation and inclusion body formation.

To evaluate expression success:

  • SDS-PAGE and western blotting to assess protein yield

  • Activity assays to confirm proper folding (functional complementation in yfgM knockout strains)

  • Co-immunoprecipitation with known interaction partners to confirm native conformation

Researchers should consider implementing a 2^8-4 factorial design (as described in ) to systematically test combinations of variables including temperature, IPTG concentration, induction time, and medium composition for optimal YfgM expression.

How can proteome-wide approaches be used to study YfgM's role in protein trafficking?

Proteome-wide studies provide valuable insights into YfgM's function within the broader context of E. coli protein secretion and membrane biogenesis. The established E. coli proteome methodologies offer several advantages for studying YfgM :

  • Two-dimensional gel electrophoresis (2-DE) with immobilized pH gradient (IPG):

    • Capable of resolving 1,000-1,500 protein spots in E. coli

    • Use narrow-range pH gradients (pH 4-5, 4.5-5.5, 5-6, etc.) to better visualize low-abundance proteins

    • Compare proteome profiles between wild-type and ΔyfgM strains to identify affected proteins

  • Quantitative proteomics approaches:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture)

    • iTRAQ (Isobaric Tags for Relative and Absolute Quantitation)

    • Label-free quantification methods

  • Secretome analysis:

    • Isolate and analyze the periplasmic fraction and outer membrane vesicles

    • Compare secreted protein profiles between wild-type and ΔyfgM strains

  • Interactome mapping:

    • Use pull-down methods combined with MS or MS/MS to comprehensively identify YfgM interaction partners

When analyzing data, researchers should utilize the extensive E. coli proteome databases such as SWISS-2DPAGE maps and SWISS-PROT, which contain rich information on proteins and corresponding genes . This approach can reveal both direct and indirect effects of YfgM deficiency on the bacterial proteome and secretome.

What is the relationship between YfgM and the periplasmic chaperone network?

YfgM's functional overlap with periplasmic chaperones SurA and Skp suggests its integration into the periplasmic quality control network . To investigate this relationship:

  • Genetic interaction studies:

    • Create single, double, and triple knockout combinations of yfgM with surA, skp, degP, ppiD, and fkpA

    • Assess synthetic phenotypes that may reveal functional redundancy or pathway dependencies

    • Measure the accumulation of misfolded proteins in the periplasm under various stress conditions

  • Substrate specificity analysis:

    • Identify which secreted proteins are most affected by YfgM deficiency

    • Compare substrate profiles with those of other periplasmic chaperones

    • Utilize proteomics approaches to categorize substrates by physical properties

  • Structural biology approaches:

    • Determine the structure of YfgM alone and in complex with interaction partners

    • Map binding interfaces and functional domains

    • Use mutational analysis to validate interaction surfaces

The experimental data suggests that YfgM may serve as a "handoff" point, accepting newly translocated proteins from the Sec machinery and directing them to appropriate periplasmic folding factors . This model can be tested using fluorescently labeled substrate proteins and tracking their movement through the secretion pathway in real-time microscopy experiments.

How can researchers design robust experiments to study YfgM function using a factorial approach?

To systematically investigate YfgM function, researchers should implement factorial experimental designs that allow for the simultaneous evaluation of multiple factors affecting protein behavior5:

  • Two-group design:

    • Compare wild-type vs. ΔyfgM strains under standard conditions

    • Measure growth rates, stress tolerance, and secretion efficiency

  • Two-group pre/post design:

    • Measure baseline parameters before and after inducing stress conditions

    • Compare how wild-type and ΔyfgM strains adapt to environmental changes

    • This design is particularly useful when maturation forms a plausible threat to internal validity5

  • Solomon four-group design:

    • Add additional control groups to account for testing effects

    • Particularly valuable when studying cellular adaptations to YfgM deficiency

  • Within/repeated measures design:

    • Follow the same bacterial populations over time under varying conditions

    • Useful for tracking dynamic processes like protein folding and secretion

For maximum internal validity, implement true experimental design elements5:

  • Manipulation of the independent variable (e.g., YfgM expression levels)

  • Comparison between conditions exposed to different levels of the variable

  • Random assignment to experimental conditions wherever possible

To analyze YfgM's role in stress response, design a factorial experiment that tests:

  • YfgM status (present vs. absent)

  • Temperature stress (optimal vs. elevated)

  • Periplasmic stress (with vs. without protein misfolding agents)

  • Membrane stress (with vs. without detergents at sub-inhibitory concentrations)

This 2^4 factorial design would yield 16 experimental conditions, providing comprehensive data on YfgM's role in maintaining cellular homeostasis under varying stressors.

What techniques can resolve contradictions in YfgM functional data?

When researchers encounter contradictory results regarding YfgM function, several methodological approaches can help resolve these discrepancies:

  • Strain background effects:

    • Compare YfgM function across multiple E. coli strains (K-12, BL21, W3110, etc.)

    • Document genetic differences between strains used in conflicting studies

    • Create isogenic strains differing only in yfgM status

  • Growth and expression conditions:

    • Systematically vary temperature, media composition, and growth phase

    • Test the effect of these variables on YfgM function

    • Implement factorial design to identify interaction effects between variables5

  • Technical approach diversification:

    • Use multiple complementary techniques to study the same phenomenon

    • Combine genetic, biochemical, and structural approaches

    • Employ both in vivo and in vitro methodologies

  • Quantitative proteomics to resolve context-dependent functions:

    • Implement narrow-range pH gradient 2-DE to better resolve the E. coli proteome

    • Compare proteome profiles under conditions where contradictory results were obtained

    • Use MS/MS for precise protein identification and quantification

Experimental ApproachStrengthsLimitationsBest For
Genetic knockoutReveals physiological relevanceMay trigger compensatory mechanismsIn vivo function
Biochemical reconstitutionDefines direct interactionsMay miss cellular contextMechanism details
Structural biologyProvides molecular mechanismStatic snapshots onlyInteraction interfaces
ProteomicsSystem-wide effectsLess sensitive for low-abundance proteinsNetwork interactions

By systematically applying these approaches and carefully documenting experimental conditions, researchers can build a more complete and consistent understanding of YfgM's multifaceted roles in E. coli physiology.

What purification strategies work best for recombinant YfgM protein?

Purifying recombinant YfgM presents challenges due to its membrane association. The following methodological approach is recommended:

  • Expression system optimization:

    • Use E. coli BL21(DE3) or C41(DE3) strains specially designed for membrane protein expression

    • Implement the optimized expression conditions described in section 2.1

    • Consider fusion tags that enhance solubility (MBP, SUMO) or aid purification (His6, Strep-tag)

  • Membrane extraction:

    • Lyse cells using French press or sonication in buffer containing protease inhibitors

    • Isolate membrane fraction through differential centrifugation

    • Solubilize membranes using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or CHAPS

  • Chromatography approach:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) for His-tagged YfgM

    • Intermediate purification: Ion exchange chromatography

    • Polishing step: Size exclusion chromatography to obtain homogeneous protein

  • Quality control assessments:

    • SDS-PAGE for purity (aim for >90%)

    • Western blotting for identity confirmation

    • Mass spectrometry for accurate molecular weight determination

    • Dynamic light scattering for homogeneity analysis

For optimal storage, maintain purified YfgM in a Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage . Avoid repeated freeze-thaw cycles, and store working aliquots at 4°C for up to one week.

How can researchers effectively analyze YfgM interactions with the SecYEG translocon?

To comprehensively analyze YfgM's interactions with the SecYEG translocon and associated components:

  • Blue Native/SDS-PAGE approach:

    • Solubilize membranes under native conditions using mild detergents

    • Perform first-dimension separation under non-denaturing conditions

    • Use second-dimension SDS-PAGE to separate complex components

    • This technique has successfully demonstrated YfgM's co-purification with SecYEG and PpiD

  • Cross-linking mass spectrometry (XL-MS):

    • Apply membrane-permeable cross-linkers to intact cells

    • Isolate cross-linked complexes and perform proteomic analysis

    • Identify cross-linked peptides to map interaction interfaces

    • This provides spatial constraints for modeling protein complexes

  • Fluorescence-based interaction assays:

    • Förster Resonance Energy Transfer (FRET) between fluorescently labeled YfgM and SecYEG components

    • Bimolecular Fluorescence Complementation (BiFC) to visualize interactions in vivo

    • Single-molecule tracking to monitor dynamic associations

  • Reconstitution in proteoliposomes:

    • Purify individual components and reconstitute into liposomes

    • Measure protein translocation activity with and without YfgM

    • Assess the impact of YfgM mutations on translocation efficiency

These approaches should be complemented with computational modeling to integrate experimental data into a coherent structural model of the YfgM-SecYEG interface. The combined data should distinguish between stable structural associations and transient functional interactions during the protein secretion process.

What are the most effective genetic approaches for studying YfgM function in vivo?

Genetic manipulation provides powerful tools for understanding YfgM function in its native cellular context:

  • Gene deletion and complementation:

    • Create precise yfgM deletion using λ-Red recombineering or CRISPR-Cas9

    • Complement with plasmid-borne wild-type or mutant yfgM under native or inducible promoters

    • Quantify rescue of phenotypes to assess functional importance of specific domains

  • Site-directed mutagenesis:

    • Target conserved residues across bacterial species

    • Focus on the transmembrane domain and regions predicted to interact with SecYEG or periplasmic chaperones

    • Create alanine-scanning libraries to map functional surfaces

  • Synthetic genetic arrays:

    • Systematically combine yfgM deletion with other gene deletions in the Sec pathway

    • Identify synthetic lethal or synthetic sick interactions

    • These genetic interactions often reveal functional relationships or parallel pathways

  • Dual fluorescent protein reporters:

    • Monitor protein folding stress using reporters like cpxP-GFP (envelope stress)

    • Track secretion efficiency using model substrates fused to fluorescent proteins

    • Quantify effects of YfgM manipulation on these cellular processes

When interpreting genetic data, consider the potential for indirect effects and compensatory mechanisms. Comparing acute depletion (using degron tags) with chronic deletion can help distinguish primary from adaptive responses to YfgM absence.

How can advanced microscopy techniques be applied to study YfgM localization and dynamics?

Advanced microscopy provides unique insights into YfgM's spatial organization and dynamics within living bacterial cells:

  • Super-resolution microscopy:

    • Structured Illumination Microscopy (SIM) achieves ~100 nm resolution

    • Stochastic Optical Reconstruction Microscopy (STORM) reaches ~20 nm resolution

    • Photoactivated Localization Microscopy (PALM) for single-molecule localization

    • These techniques can resolve YfgM clusters and association with Sec translocons

  • Single-particle tracking:

    • Tag YfgM with photoactivatable fluorescent proteins

    • Track movement of individual molecules in living cells

    • Calculate diffusion coefficients under various conditions

    • Determine if YfgM shows constrained diffusion near Sec translocons

  • Fluorescence Recovery After Photobleaching (FRAP):

    • Measure mobility of fluorescently labeled YfgM in the membrane

    • Quantify exchange rates between mobile and immobile pools

    • Compare dynamics in wild-type cells vs. those lacking interaction partners

  • Fluorescence Lifetime Imaging Microscopy (FLIM):

    • Detect protein-protein interactions through changes in fluorescence lifetime

    • Map interaction territories within the cell membrane

    • Monitor how interactions change during active protein secretion

Sample preparation is critical for membrane protein imaging. Use minimal fixation protocols that preserve native membrane organization, and validate findings with complementary techniques such as electron microscopy of immunogold-labeled samples.

How should researchers integrate multi-omics data to understand YfgM's role in the E. coli proteome?

Understanding YfgM's role requires integrating data from multiple omics approaches:

  • Proteomics integration:

    • Compare 2-DE protein patterns between wild-type and ΔyfgM strains

    • Use narrow-range pH gradients to maximize proteome coverage

    • Quantify changes in abundance of secreted proteins, periplasmic chaperones, and membrane proteins

  • Transcriptomics correlation:

    • Perform RNA-seq to identify genes with altered expression in ΔyfgM strains

    • Look for activation of stress response pathways (σE, Cpx, Bae)

    • Cross-reference with proteomics data to identify post-transcriptional effects

  • Interactomics mapping:

    • Create comprehensive interaction networks using pull-down/MS approaches

    • Validate key interactions with targeted biochemical assays

    • Build interaction maps that integrate YfgM into known secretion and chaperone networks

  • Phenomics analysis:

    • Measure growth phenotypes under diverse conditions

    • Use Biolog phenotype arrays to test hundreds of growth conditions simultaneously

    • Correlate phenotypic changes with molecular data

Data integration strategies:

  • Use pathway enrichment analysis to identify affected cellular processes

  • Apply machine learning algorithms to identify patterns across datasets

  • Develop predictive models of YfgM function based on integrated data

  • Visualize networks using tools like Cytoscape with E. coli-specific plugins

The E. coli proteome provides an excellent model for integration due to comprehensive public databases, well-established 2-DE maps, and relatively simple proteome compared to eukaryotes .

What statistical approaches are most appropriate for analyzing YfgM experimental data?

  • For factorial experimental designs:

    • Analysis of Variance (ANOVA) to assess effects of multiple factors

    • Use post-hoc tests (Tukey's HSD, Bonferroni) for multiple comparisons

    • Include interaction terms to identify synergistic effects between factors5

  • For proteomics data:

    • Implement normalization procedures appropriate for 2-DE or MS data

    • Use false discovery rate (FDR) correction for multiple hypotheses testing

    • Apply clustering algorithms to identify proteins with similar expression patterns

    • Consider dimensionality reduction techniques (PCA, t-SNE) for visualizing complex datasets

  • For microscopy and localization studies:

    • Implement automated image analysis workflows for unbiased quantification

    • Use appropriate statistical tests for distribution comparisons (Kolmogorov-Smirnov)

    • Calculate confidence intervals for diffusion coefficients and interaction frequencies

  • For genetic interaction studies:

    • Calculate genetic interaction scores based on deviation from expected phenotypes

    • Apply network analysis algorithms to identify functional modules

    • Use bootstrapping approaches to assess the robustness of network models

When designing experiments, perform power analysis to determine appropriate sample sizes, and consider using the two-group pre/post design for improved detection of effects in small samples5. For complex datasets, consult with statisticians during both experimental design and data analysis phases to ensure appropriate statistical approaches.

How can computational approaches aid in understanding YfgM structure and function?

Computational methods complement experimental approaches in elucidating YfgM's structure and function:

  • Structural modeling:

    • Use homology modeling based on related proteins

    • Apply ab initio modeling for unique regions

    • Refine with molecular dynamics simulations in membrane environments

    • Predict protein-protein interaction interfaces

  • Sequence analysis:

    • Perform multiple sequence alignment across bacterial species

    • Identify conserved residues as candidates for functional importance

    • Use conservation patterns to predict functional domains

    • Analyze coevolution patterns to infer interaction partners

  • Systems biology modeling:

    • Develop mathematical models of the Sec secretion pathway

    • Simulate the effects of YfgM perturbation on system behavior

    • Generate testable predictions about pathway dynamics

    • Integrate experimental data to refine and validate models

  • Machine learning applications:

    • Train algorithms to predict proteins dependent on YfgM for proper secretion

    • Identify sequence or structural features that determine YfgM dependency

    • Use deep learning approaches to find patterns in large-scale phenotypic data

The computational analysis should be iteratively refined with experimental validation, creating a virtuous cycle where computational predictions guide experiments, and experimental results improve computational models.

What are the most promising future research directions for YfgM studies?

Several promising research directions could significantly advance our understanding of YfgM:

  • High-resolution structural studies:

    • Cryo-electron microscopy of YfgM in complex with SecYEG and periplasmic chaperones

    • X-ray crystallography of soluble YfgM domains with interaction partners

    • NMR studies of dynamic regions and binding interfaces

  • Single-molecule approaches:

    • Real-time tracking of individual secreted proteins as they interact with YfgM

    • Force spectroscopy to measure binding kinetics and energetics

    • Single-molecule FRET to detect conformational changes during protein handoff

  • Systems-level analysis:

    • Global genetic interaction mapping to position YfgM in cellular networks

    • Quantitative proteomics under diverse stress conditions

    • Integration of multiple omics datasets to build predictive models

  • Translational applications:

    • Explore YfgM as a potential antimicrobial target

    • Engineer enhanced secretion systems incorporating optimized YfgM variants

    • Develop biosensors based on YfgM-dependent secretion

These directions should be pursued using the factorial experimental design approaches discussed earlier5, systematically exploring how multiple variables interact to influence YfgM function in different contexts.

How can contradictory findings about YfgM function be reconciled through improved experimental design?

Contradictions in research findings can be addressed through rigorous experimental design:

  • Standardize experimental conditions:

    • Adopt consistent growth media, temperatures, and strain backgrounds

    • Document all experimental parameters thoroughly

    • Implement factorial designs to systematically test condition effects5

  • Use multiple complementary techniques:

    • Verify key findings using orthogonal methodologies

    • Combine genetic, biochemical, and imaging approaches

    • Assess both steady-state and kinetic parameters

  • Control for indirect effects:

    • Use acute depletion systems to distinguish primary from adaptive responses

    • Implement genetic suppressor screens to identify compensatory mechanisms

    • Develop reconstituted systems to test direct effects

  • Improve statistical rigor:

    • Increase biological and technical replicates

    • Perform appropriate statistical tests with correction for multiple comparisons

    • Report effect sizes alongside statistical significance

    • Implement blinding procedures where applicable

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.