Recombinant Escherichia coli UPF0092 membrane protein YajC (yajC)

What is YajC and what is its basic structure?

YajC is a small membrane protein (110 amino acids) that functions as a subunit of the preprotein translocase complex in bacteria. The full amino acid sequence of E. coli YajC is: MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGTMKAL . This protein typically contains transmembrane domains that anchor it to the bacterial membrane, with regions that interact with other components of the translocation machinery. The protein structure suggests its role as a scaffold or modulator in protein translocation complexes.

What cellular pathways involve YajC?

YajC participates in two primary cotranslational membrane protein-insertion pathways: the signal recognition particle (SRP)-SecYEG-YajC-YidC1 pathway and the SRP-YajC-YidC2 pathway . As part of these systems, YajC interacts with membrane proteins SecD and SecF to coordinate protein transport and secretion across the cytoplasmic membrane . Research suggests that YajC may function in stabilizing these complexes or in retaining proteins for proper docking to the YidC insertases for translocation across the membrane .

How is YajC evolutionarily conserved across bacterial species?

YajC appears to be a highly conserved membrane protein across diverse bacterial species including E. coli, Enterococcus faecium, Lactobacillus buchneri, and Streptococcus mutans . This conservation suggests essential functions in bacterial physiology. Despite sequence variations between species, the functional roles in protein translocation and membrane insertion pathways remain largely consistent, making it an interesting target for comparative genomic studies.

How does YajC contribute to the holo-translocon (HTL) complex?

YajC is an integral component of the bacterial holo-translocon (HTL), which consists of SecYEG–SecDF–YajC–YidC subunits. Unlike the homo-dimeric SecYEG, the HTL forms a hetero-dimer composed of single copies of SecYEG and SecDF–YajC–YidC . The HTL complex demonstrates enhanced capabilities compared to SecYEG alone, particularly in cotranslational insertion of membrane proteins. Additionally, when YajC is incorporated into the HTL, the posttranslational secretion of β-barreled outer-membrane proteins driven by SecA and ATP becomes significantly more dependent on the proton-motive force . This suggests that YajC helps modulate the activity of the translocating copy of SecYEG through its association with different accessory subcomplexes.

What experimental approaches are most effective for studying YajC function?

Several experimental approaches have proven effective for investigating YajC function:

• Gene deletion studies: Creating ΔyajC mutants and analyzing phenotypic changes, particularly in processes like biofilm formation .

• Overexpression systems: Using vectors like pET28b for controlled expression of the protein in model organisms .

• Proteomic analysis: Mass spectrometry to identify changes in protein expression and interactions when YajC is deleted or overexpressed .

• Reconstitution experiments: Purifying the components of the translocation machinery to study their interactions and activities in vitro .

• In vivo models: Animal models such as rat endocarditis models to study the effects of YajC mutations on bacterial pathogenesis .

These approaches allow researchers to probe both the structural interactions and functional significance of YajC in various cellular contexts.

How does YajC respond to environmental stressors?

YajC demonstrates remarkable responsiveness to environmental stressors, particularly ethanol. In Lactobacillus buchneri, YajC protein expression increased 15-fold in response to 10% ethanol compared to control conditions . Furthermore, overexpression of L. buchneri yajC in E. coli conferred tolerance to 4% ethanol in growth media . This suggests that YajC may play a role in stress response mechanisms beyond its function in protein translocation. YajC has also been linked to sensitivity to growth temperatures in E. coli, indicating its potential involvement in thermal stress adaptation mechanisms .

What is the molecular mechanism by which YajC influences biofilm formation?

YajC plays a critical role in biofilm formation, particularly in pathogenic bacteria like Enterococcus faecium. Deletion of yajC significantly impairs biofilm formation in vitro and attenuates virulence in a rat endocarditis model . Mass spectrometry analysis of ΔyajC mutant supernatants revealed increased amounts of cytoplasmic and cell-surface-located proteins, including biofilm-associated proteins . This suggests that YajC may be essential for proper attachment of surface proteins, which are critical for biofilm formation.

The mechanism appears to involve YajC's role in the cotranslational membrane protein insertion pathways. Proteins on the surface of yajC mutants seem to be only loosely attached, suggesting that YajC is involved in:

• Stabilization of the SRP-SecYEG-YajC-YidC1 and SRP-YajC-Yid2 pathways

• Retaining proteins for proper docking to the YidC insertases

• Facilitating proper translocation of proteins in and across the membrane

How does the stoichiometry of YajC in different protein complexes affect function?

The stoichiometry of YajC within protein complexes significantly impacts their functionality. In the HTL, there appears to be a 1:1 ratio between the SecYEG complex and the SecDF–YajC–YidC subcomplex, forming a hetero-dimer . This specific stoichiometry is crucial for the enhanced activity of the HTL in cotranslational membrane protein insertion compared to SecYEG alone.

Analysis of transposon insertion libraries in E. faecium revealed a 71.51-fold change in YajC expression when comparing unselected control libraries to biofilm-deficient enriched libraries, as shown in Table 1 :

This suggests that the relative abundance of YajC compared to other components is critical for proper function, particularly in processes like biofilm formation.

What are the implications of YajC function for bacterial pathogenesis?

YajC has significant implications for bacterial pathogenesis through multiple mechanisms:

• Biofilm formation: In E. faecium, YajC is critical for biofilm formation, a key virulence factor that contributes to antibiotic resistance and persistence during infection .

• Virulence factor translocation: YajC has been implicated in the translocation of virulence factors during Listeria infection, suggesting a direct role in pathogenesis .

• Immune response modulation: YajC can stimulate T cell-mediated responses during Brucella abortus infection, indicating its potential role in host-pathogen interactions .

• Stress adaptation: YajC's involvement in ethanol tolerance suggests it may also contribute to bacterial survival under host-induced stress conditions .

These findings highlight YajC as a potential target for novel antimicrobial strategies, particularly those aimed at disrupting biofilm formation or bacterial protein secretion systems.

What are the challenges and solutions in expressing and purifying recombinant YajC?

Expressing and purifying membrane proteins like YajC presents several challenges:

Challenges:

• Low expression levels due to toxicity or membrane integration issues

• Proper folding in heterologous systems

• Solubility concerns due to hydrophobic transmembrane domains

• Maintaining protein stability during purification

Solutions:

• Expression system optimization: Using E. coli as an expression host with N-terminal His-tag fusion for detection and purification .

• Buffer conditions: Using Tris/PBS-based buffer with 6% Trehalose at pH 8.0 for storage .

• Storage recommendations: Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use. Adding 5-50% glycerol (final concentration) and avoiding repeated freeze-thaw cycles can maintain protein stability .

• Reconstitution protocol: Centrifuge vials briefly before opening, reconstitute in deionized sterile water to 0.1-1.0 mg/mL, and add glycerol for long-term storage .

How can researchers effectively study YajC-protein interactions in vitro?

To effectively study YajC-protein interactions:

• Reconstitution of the holo-translocon: Purify individual components and reconstitute the complex in controlled conditions to study interactions and activity .

• Comparative activity assays: Compare the activities of the HTL versus SecYEG alone in cotranslational insertion of membrane proteins and posttranslational secretion of outer membrane proteins .

• Proteomic approaches: Use mass spectrometry analysis of supernatants from wild-type and ΔyajC mutants to identify proteins that interact with or are processed by YajC-containing complexes .

• Crosslinking studies: Employ chemical crosslinking followed by mass spectrometry to capture transient interactions between YajC and other proteins.

• Fluorescence-based interaction assays: Use techniques like FRET (Förster Resonance Energy Transfer) to monitor real-time interactions between labeled YajC and potential binding partners.

What genetic approaches are most informative for functional characterization of YajC?

Several genetic approaches have proven valuable for YajC functional characterization:

• Gene knockouts: Creating ΔyajC mutants allows assessment of phenotypic changes, such as impaired biofilm formation or altered protein secretion profiles .

• Complementation studies: Reintroducing yajC into knockout strains to confirm that observed phenotypes are specifically due to YajC absence.

• Overexpression systems: Using inducible promoters (like in pET28b vectors) to study the effects of increased YajC levels, such as enhanced ethanol tolerance .

• Domain mapping: Creating truncated or mutated versions of YajC to identify functional domains important for specific interactions or activities.

• Interspecies gene swapping: Replacing native yajC with homologs from other bacterial species to determine conserved and species-specific functions. For example, expressing L. buchneri yajC in E. coli revealed ethanol tolerance functions .

These approaches collectively provide powerful tools for dissecting the multifaceted roles of YajC in bacterial physiology and pathogenesis.