Recombinant Escherichia coli UPF0126 inner membrane protein yicG (yicG)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant YicG Protein

The recombinant Escherichia coli UPF0126 inner membrane protein yicG (yicG) is a bioengineered form of the naturally occurring yicG protein, expressed in E. coli with modifications for enhanced solubility and purification. This protein belongs to the UPF0126 family, characterized by multi-pass transmembrane domains and conserved structural motifs .

Key Features of Recombinant YicG

PropertyDescription
SequenceFull-length (1–205 amino acids) with N-terminal His-tag
Purity>90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Subcellular LocalizationInner membrane of E. coli
FamilyUPF0126 family (sequence homology with membrane proteins of unknown function)

Amino Acid Sequence and Transmembrane Domains

The yicG protein contains seven predicted transmembrane helices, as inferred from sequence analysis . Its amino acid sequence includes hydrophobic and hydrophilic regions critical for membrane integration:

DomainSequence Segment
N-TerminalMLLHILYLVGITAEAMTGALAAGRRRMDTFGVIIIATATAIGGGSVRDILLGHYPLGWVK
CentralHPEYVIIVATAAVLTTIVAPVMPYLRKVFLVLDALGLVVFSIIGAQVALDMGHGPIIAVVAAVTTGVFGGVLRDMFCKRIPLVFQKELYAGVSFASAVLYIALQHYVSNHDVVIISTLVFGFFARLLALRLKLGLPVFYYSHEGH

The His-tag facilitates purification via nickel affinity chromatography .

Production and Purification

Recombinant yicG is produced in E. coli via plasmid-based expression systems. Key steps include:

  1. Cloning: Insertion of the yicG gene into a T7 promoter-driven vector.

  2. Induction: IPTG-mediated induction of T7 RNA polymerase to initiate transcription .

  3. Purification:

    • Cell Lysis: Mechanical disruption of E. coli cells.

    • Ni-NTA Chromatography: Capture of His-tagged yicG.

    • Lyophilization: Final product stored as lyophilized powder .

Challenges in Production

High-level expression of yicG can cause toxicity in E. coli, necessitating optimization of induction conditions (e.g., low IPTG concentrations) . Post-purification, repeated freeze-thaw cycles must be avoided to maintain stability .

Role in Membrane Protein Dynamics

While the exact function of yicG remains unclear, its structural homology to UPF0126 family proteins suggests roles in:

  • Membrane remodeling: Interactions with lipid bilayers or membrane-bound complexes.

  • Protein quality control: Chaperoning misfolded membrane proteins .

Applications in Research

ApplicationDetails
Structural StudiesX-ray crystallography or cryo-EM to resolve transmembrane domain arrangements
Membrane Protein InteractionsCo-immunoprecipitation assays to identify binding partners (e.g., YidC, SecYEG complex)
Functional ScreeningMutagenesis studies to map regions critical for membrane stability

Comparative Genomic Context

E. coli genomes exhibit conserved yicG gene clusters, though its absence in some pathogenic strains (e.g., Shigella) hints at niche-specific roles .

Emerging Connections to Stress Response

Homologs in Salmonella (e.g., YicC) are implicated in stress adaptation, suggesting potential roles for yicG in maintaining membrane integrity under environmental stress .

Limitations in Current Knowledge

  • No enzymatic activity: Unlike related UPF0126 proteins (e.g., YicI, YihQ) , yicG lacks confirmed catalytic function.

  • Lack of high-resolution structures: No crystallographic or cryo-EM data for yicG; structural inferences rely on homology to YidC .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yicG; b3646; JW3621; UPF0126 inner membrane protein YicG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yicG
Target Protein Sequence
MLLHILYLVGITAEAMTGALAAGRRRMDTFGVIIIATATAIGGGSVRDILLGHYPLGWVK HPEYVIIVATAAVLTTIVAPVMPYLRKVFLVLDALGLVVFSIIGAQVALDMGHGPIIAVV AAVTTGVFGGVLRDMFCKRIPLVFQKELYAGVSFASAVLYIALQHYVSNHDVVIISTLVF GFFARLLALRLKLGLPVFYYSHEGH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0126 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the YicG protein and what is its classification?

YicG (UniProt ID: P0AGM2) is classified as a UPF0126 family inner membrane protein in Escherichia coli. It is a full-length protein consisting of 205 amino acids (1-205aa) and is predicted to be an integral membrane protein. The gene is also known by several synonyms including b3646 and JW3621 . The UPF0126 domain is characteristic of this protein family, and proteins containing this domain are consistently predicted to be membrane proteins based on their structural characteristics .

What is the proposed biological function of YicG protein?

Recent research suggests that proteins containing the UPF0126 domain, including YicG, are specifically important for glycine utilization in bacteria. Based on experimental evidence, UPF0126 proteins are proposed to function as glycine transporters . Studies have shown that individual mutants of three members of this family had reduced growth on glycine, and specifically, PGA1_c00920 (another UPF0126 family member) partially rescues the glycine growth defect of an E. coli strain lacking the known glycine transporter CycA . This functional association with glycine metabolism represents a significant advance in understanding previously uncharacterized membrane proteins.

What is the recommended storage protocol for recombinant YicG protein?

For optimal stability and activity, the recombinant YicG protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles. For short-term storage, working aliquots can be maintained at 4°C for up to one week . The protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

What is the recommended protocol for reconstituting recombinant YicG protein?

The optimal reconstitution protocol involves:

  • Briefly centrifuging the vial prior to opening to bring contents to the bottom

  • Reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Adding glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

  • Aliquoting for long-term storage at -20°C/-80°C

This protocol minimizes protein degradation and maintains structural integrity for functional studies. The addition of glycerol is particularly important as it prevents ice crystal formation during freezing, which can denature membrane proteins.

How can researchers validate the structural integrity of recombinant YicG protein?

For quality assessment of recombinant YicG protein, SDS-PAGE analysis is the standard method for purity verification, with commercial preparations typically showing greater than 90% purity . For structural validation, researchers should consider:

  • Circular dichroism (CD) spectroscopy to assess secondary structure components

  • Size exclusion chromatography to confirm proper folding and absence of aggregation

  • Limited proteolysis assays to verify structural integrity

  • Western blotting with anti-His antibodies to confirm tag presence

These complementary techniques provide a comprehensive assessment of protein quality before proceeding with functional studies.

What experimental approaches are recommended for investigating YicG's proposed glycine transporter function?

Based on current research findings suggesting YicG's role in glycine transport , the following experimental approaches are recommended:

  • Growth complementation assays: Testing whether expression of yicG can rescue growth defects in E. coli strains lacking known glycine transporters (such as cycA knockouts)

  • Isotope-labeled glycine uptake assays: Measuring the uptake of 14C or 13C-labeled glycine in cells overexpressing YicG versus control cells

  • Liposome reconstitution experiments: Incorporating purified YicG into artificial liposomes to directly measure glycine transport capacity

  • Site-directed mutagenesis: Identifying key residues involved in substrate binding or translocation by creating point mutations

This multi-faceted approach would provide strong evidence to confirm or refine the glycine transporter hypothesis for YicG function.

How does YicG compare to other characterized membrane transporters in E. coli?

YicG belongs to the UPF0126 family of inner membrane proteins, which are structurally distinct from the major facilitator superfamily (MFS) and ATP-binding cassette (ABC) transporters that dominate E. coli's transporter repertoire. Unlike the well-characterized CycA glycine transporter, which functions as a sodium:glycine symporter, the mechanism of glycine transport by UPF0126 family proteins remains to be elucidated .

Key differences include:

  • YicG lacks the canonical nucleotide-binding domains found in ABC transporters

  • The protein has a unique topology compared to MFS transporters

  • Its function appears more specialized for glycine utilization compared to the broader substrate specificity of many E. coli transporters

These distinctions make YicG an interesting subject for comparative structural and functional analyses of bacterial transporters.

What bioinformatic approaches can be used to predict structural features of YicG?

For researchers investigating the structural characteristics of YicG, several computational approaches are recommended:

  • Transmembrane domain prediction: Programs such as TMHMM, Phobius, or TOPCONS can predict the membrane-spanning regions of YicG

  • Protein structure prediction: AlphaFold2 or RoseTTAFold can generate 3D structural models based on the amino acid sequence

  • Structural homology modeling: Using the I-TASSER or SWISS-MODEL servers to identify structural homologs and generate comparative models

  • Molecular dynamics simulations: To predict protein-membrane interactions and conformational changes

These computational predictions provide a valuable framework for designing experimental approaches to validate structural features and their relationship to function.

How can knockout or knockdown studies be designed to investigate YicG function?

To investigate the function of YicG through gene disruption approaches:

  • CRISPR-Cas9 genome editing:

    • Design gRNAs targeting the yicG gene

    • Create clean deletions or insertions to disrupt gene function

    • Compare growth phenotypes under various conditions, particularly with glycine as the sole carbon or nitrogen source

  • Transposon mutagenesis screening:

    • Generate a library of E. coli transposon mutants

    • Screen for growth defects specifically on glycine-containing media

    • Confirm the role of YicG by complementation with the wild-type gene

  • RNAi or antisense RNA approaches (for partial knockdown):

    • Design antisense oligonucleotides targeting yicG mRNA

    • Titrate expression levels to identify threshold effects

    • Monitor glycine uptake rates at different expression levels

These approaches would help establish the essentiality and specific functions of YicG in E. coli metabolism.

What are the key considerations for designing protein-protein interaction studies involving YicG?

For investigating potential interaction partners of YicG:

  • Membrane protein-specific techniques:

    • Chemical crosslinking followed by mass spectrometry

    • Split-ubiquitin yeast two-hybrid system (specifically designed for membrane proteins)

    • FRET-based interaction assays using fluorescently tagged proteins

  • Experimental conditions:

    • Maintain proper membrane environment during extraction (use appropriate detergents)

    • Consider using membrane mimetics like nanodiscs or liposomes

    • Test interactions under various metabolic conditions, particularly in the presence/absence of glycine

  • Controls and validation:

    • Include known membrane protein interaction pairs as positive controls

    • Use unrelated membrane proteins as negative controls

    • Validate key interactions through multiple orthogonal methods

Identifying interaction partners would provide valuable insights into how YicG functions within the broader context of cellular metabolism and transport processes.

What are the common technical challenges in expressing and purifying recombinant YicG protein?

Membrane proteins like YicG present several challenges during recombinant expression and purification:

ChallengeSolution
Toxicity during overexpressionUse tightly regulated inducible promoters (e.g., pBAD)
Protein misfoldingExpress at lower temperatures (16-20°C)
Inclusion body formationCo-express with chaperones (GroEL/GroES)
Low yieldOptimize codon usage for E. coli expression
Maintaining structural integrityUse mild detergents (DDM, LMNG) for extraction
Aggregation during purificationInclude stabilizing agents like glycerol or specific lipids
Difficulty in tag removalDesign constructs with TEV protease cleavage sites

Researchers should optimize these parameters based on specific experimental goals and downstream applications.

How can researchers troubleshoot functional assays involving YicG protein?

When functional assays for YicG do not yield expected results, consider the following troubleshooting approaches:

  • For transport assays:

    • Verify protein orientation in reconstituted systems

    • Test different pH and ionic conditions

    • Ensure membrane integrity during assays

    • Consider co-factors that might be required for activity

  • For in vivo assays:

    • Check expression levels by Western blotting

    • Verify cellular localization by fractionation or fluorescence microscopy

    • Control for compensatory effects from other transporters

    • Test multiple growth conditions to identify specific phenotypes

  • General considerations:

    • Ensure protein quality before functional testing

    • Include positive controls with known transport activity

    • Consider the impact of His-tags on function

    • Use freshly prepared protein samples when possible

Systematic troubleshooting can help distinguish between true negative results and technical limitations of the assays.

How might YicG function be relevant to bacterial physiology and metabolism?

The proposed glycine transport function of YicG has several potential implications for bacterial physiology:

  • Metabolic flexibility: Enabling the utilization of glycine as a carbon and nitrogen source could provide a competitive advantage in certain ecological niches

  • Stress response: Glycine accumulation has been linked to osmotic stress tolerance in some bacteria

  • Cell wall synthesis: Glycine is a component of peptidoglycan, so controlled transport could impact cell wall integrity

  • One-carbon metabolism: Glycine feeds into one-carbon metabolic pathways critical for nucleotide synthesis

Future research could explore how YicG expression and function vary under different growth conditions or stress scenarios to better understand its physiological role.

What are promising directions for structural biology studies of YicG?

For researchers interested in the structural characterization of YicG:

  • Cryo-electron microscopy (cryo-EM):

    • Purify YicG in membrane-mimetic environments like nanodiscs

    • Obtain high-resolution structures in different conformational states

    • Identify potential substrate binding sites

  • X-ray crystallography:

    • Screen detergents and lipids for optimal crystallization conditions

    • Consider fusion proteins to facilitate crystallization

    • Co-crystallize with potential substrates or inhibitors

  • NMR spectroscopy:

    • Focus on specific domains or peptide fragments

    • Use solid-state NMR for full-length protein in membrane environments

    • Investigate dynamics and conformational changes upon substrate binding

These structural studies would significantly advance our understanding of the molecular mechanism of YicG function and potentially open avenues for structure-based drug design targeting bacterial transport systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.