Recombinant Escherichia coli UPF0187 protein yneE (yneE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs unless dry ice is requested in advance. Dry ice shipping incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yneE; b1520; JW5245; UPF0187 protein YneE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yneE
Target Protein Sequence
MIVRPQQHWLRRIFVWHGSVLSKISSRLLLNFLFSIAVIFMLPWYTHLGIKFTLAPFSIL GVAIAIFLGFRNNAGYARYVEARKLWGQLMIASRSLLREVKTTLPDSASVREFARLQIAF AHCLRMTLRKQPQAEVLAHYLKTEDLQRVLASNSPANRILLIMGEWLAVQRRNGQLSDIL FISLNDRLNDISAVLAGCERIAYTPIPFAYTLILHRTVYLFCIMLPFALVVDLHYMTPFI SVLISYTFISLDCLAEELEDPFGTENNDLPLDAICNAIEIDLLQMNDEAEIPAKILPDRH YQLT
Uniprot No.

Target Background

Database Links
Protein Families
UPF0187 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant yneE protein production?

E. coli expression systems have been established as effective for recombinant yneE protein production. The most commonly documented approach involves N-terminal His-tag fusion expression in E. coli, which facilitates subsequent purification steps .

When optimizing expression conditions, consider the following parameters:

ParameterRecommended ConditionRationale
Expression hostE. coliNative environment, proper folding machinery
Tag placementN-terminal His-tagFacilitates purification while minimizing functional interference
InductionIPTG at mid-log phaseBalances protein yield with proper folding
Temperature25-30°C post-inductionReduces inclusion body formation
Growth mediaLB supplemented with appropriate antibioticsMaintains plasmid stability

For membrane proteins like yneE, lower post-induction temperatures often improve proper folding and functional yield despite potentially reducing total protein production .

What are the optimal storage conditions for maintaining yneE protein stability?

Based on experimental data, optimal storage conditions for recombinant yneE protein include:

  • Short-term storage (up to one week): 4°C in appropriate buffer systems

  • Long-term storage: -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles

  • Storage buffer: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Reconstitution: Deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Cryoprotection: Addition of glycerol (final concentration 50%) for preventing freeze-damage

Researchers should note that repeated freeze-thaw cycles significantly impact protein stability and functional integrity. Creating small working aliquots during initial preparation is strongly recommended for preserving sample quality throughout the research timeline .

What experimental design considerations are critical when studying yneE protein interactions?

When designing experiments to investigate yneE protein interactions, researchers should implement a systematic approach addressing multiple variables that could influence experimental outcomes. The experimental design should follow these key considerations:

  • Control selection: Include both positive controls (known membrane protein interactions) and negative controls (non-interacting proteins) to validate your experimental system .

  • Variable isolation: Systematically identify and control extraneous variables that could confound your results, including:

    • Expression levels of interaction partners

    • Cellular localization confirmation

    • Detergent/solubilization conditions

    • Buffer composition effects on interaction stability

  • Between-subjects vs. within-subjects design: For comparative studies examining different constructs or conditions, determine whether a between-subjects design (different samples for each condition) or within-subjects design (same sample under multiple conditions) is most appropriate .

  • Data collection planning: Establish clear metrics for measuring interaction strength or specificity before beginning experiments, including statistical analysis approaches .

A robust experimental design might include multiple complementary methods to validate protein interactions:

MethodStrengthsLimitationsControl Considerations
Co-immunoprecipitationIn vivo context, native interactionsPotential for non-specific bindingAntibody specificity validation
Bacterial two-hybridSpecific for direct interactionsRequires nuclear localizationSelf-activation tests
FRET/BRET analysisReal-time, in vivo measurementsRequires fluorescent tag validationTag interference controls
Surface plasmon resonanceQuantitative binding kineticsRequires purified componentsReference surface controls

How should researchers approach contradictory data when analyzing yneE function?

When encountering contradictory data regarding yneE function, researchers should implement a systematic analytical framework:

  • Methodological examination: First, critically evaluate methodological differences between contradictory studies:

    • Expression systems and tags used

    • Purification approaches

    • Assay conditions (buffers, temperatures, pH)

    • Detection methods and their sensitivity thresholds 4

  • Technical validation: Replicate key experiments using multiple techniques to confirm observations:

    • If contradictions exist between structural predictions and functional data, employ orthogonal structural analysis methods

    • Validate protein activity using both in vitro and in vivo approaches

  • Physiological context consideration: Assess whether contradictions might represent genuine biological variability:

    • Growth conditions affecting yneE expression

    • Strain-specific differences in yneE regulation

    • Interactions with different cellular components under varying conditions

  • Hypothesis refinement: Develop revised hypotheses that could potentially reconcile contradictory observations:

    • Context-dependent protein functions

    • Multi-functional properties under different conditions

    • Previously unrecognized post-translational modifications 4

When presenting contradictory findings, researchers should carefully document all experimental conditions and avoid oversimplification of complex biological systems. This transparent approach aids the scientific community in constructing more accurate models of yneE function .

What analytical techniques are most appropriate for characterizing yneE membrane topology?

Characterizing the membrane topology of yneE requires specialized techniques that can provide spatial information about protein regions relative to the membrane:

  • Cysteine accessibility methods:

    • Substitute native cysteines with alanines

    • Introduce single cysteines at positions of interest

    • Probe accessibility using membrane-permeable and impermeable thiol-reactive reagents

    • This approach can distinguish cytoplasmic, periplasmic, and transmembrane domains

  • Protease protection assays:

    • Prepare inside-out and right-side-out membrane vesicles

    • Treat with proteases and analyze fragmentation patterns

    • Protected fragments indicate membrane-embedded regions

  • Fluorescence-based approaches:

    • GFP-fusion analysis at different positions

    • pH-sensitive fluorescent proteins can distinguish cellular compartments

    • FRET pair positioning can provide distance constraints between domains

  • Computational validation:

    • Compare experimental results with predictions from multiple topology algorithms

    • Resolve discrepancies through additional targeted experiments

For comprehensive characterization, researchers should employ at least three independent techniques and cross-validate the results. The 304-amino acid sequence of yneE suggests multiple potential transmembrane segments that require careful experimental validation .

What are the best practices for designing knockout and complementation studies involving yneE?

When designing knockout and complementation studies for yneE, researchers should implement a comprehensive methodological framework:

  • Knockout strategy selection:

    • Complete gene deletion using λ-Red recombination system provides clean genetic background

    • Insertion inactivation (antibiotic cassette) offers selection advantages

    • CRISPR-Cas9 approaches enable precise genomic modifications

    • Consider polar effects on downstream genes when selecting approach 4

  • Phenotypic validation:

    • Confirm knockout at DNA level (PCR), RNA level (qRT-PCR), and protein level (Western blot)

    • Implement comprehensive phenotypic screening covering:

      • Growth kinetics under various conditions

      • Membrane integrity assessments

      • Stress response profiling

      • Transcriptomic changes in related pathways

  • Complementation design:

    • Express yneE from native promoter when possible

    • Control expression levels to match physiological conditions

    • Include both tagged and untagged versions to assess tag interference

    • Test complementation from both plasmid and chromosomal integration 4

  • Controls and validation:

    • Include wild-type controls from parental strain

    • Use empty vector controls for plasmid-based complementation

    • Test complementation with mutated versions to identify critical residues

    • Quantify expression levels of complementing constructs

This systematic approach ensures that phenotypes can be confidently attributed to yneE function rather than secondary effects of genetic manipulation or non-physiological expression levels 4.

How can researchers optimize purification protocols for recombinant yneE protein?

Optimizing purification of recombinant yneE requires systematic protocol refinement addressing key challenges associated with membrane proteins:

  • Solubilization optimization:

    • Screen multiple detergents including:

      • Mild non-ionic detergents (DDM, LMNG)

      • Zwitterionic detergents (CHAPS, FC-16)

      • Novel amphipols and nanodiscs for increased stability

    • Optimize detergent:protein ratios through small-scale trials

    • Consider mixed detergent systems for improved extraction efficiency

  • Affinity purification refinement:

    • For His-tagged constructs, compare Ni-NTA, Co-NTA, and TALON resins

    • Optimize imidazole concentrations in wash and elution buffers

    • Consider on-column detergent exchange during washing steps

    • Implement low-temperature purification (4°C) to minimize degradation

  • Chromatographic resolution:

    • Follow affinity purification with size exclusion chromatography

    • Monitor oligomeric state and homogeneity

    • Assess detergent micelle contribution to apparent molecular weight

    • Consider ion exchange chromatography for removing contaminants

  • Quality assessment metrics:

    • SDS-PAGE purity (target >90%)

    • Western blot confirmation

    • Mass spectrometry validation

    • Circular dichroism to confirm secondary structure integrity

The optimal purification strategy for His-tagged yneE (1-304) involves initial IMAC purification followed by size exclusion chromatography, achieving >90% purity while maintaining structural integrity. Researchers should store purified protein in Tris/PBS-based buffer with 6% trehalose (pH 8.0) and add glycerol to a final concentration of 50% for long-term storage at -80°C .

What experimental approaches can elucidate potential interaction partners of yneE protein?

To systematically identify and validate yneE protein interaction partners, researchers should implement complementary approaches that balance throughput with specificity:

  • Unbiased screening methods:

    • Bacterial two-hybrid screening against genomic libraries

    • Co-immunoprecipitation coupled with mass spectrometry

    • Proximity-dependent biotin identification (BioID)

    • Cross-linking mass spectrometry (XL-MS) for transient interactions

  • Targeted validation approaches:

    • Co-purification with candidate partners

    • Microscale thermophoresis for quantitative binding parameters

    • Biolayer interferometry for kinetic interaction analysis

    • FRET/BRET analysis for in vivo confirmation

  • Functional validation strategies:

    • Genetic epistasis analysis with candidate interactors

    • Phenotypic analysis of double mutants

    • Suppressor screening to identify genetic interactions

    • Competition assays to assess binding specificity 4

  • Data integration framework:

    • Cross-reference with existing protein-protein interaction databases

    • Implement bioinformatic filtering for membrane protein interactions

    • Consider conservation patterns across bacterial species

    • Develop network models incorporating interaction confidence scores

When analyzing potential interactions, researchers should carefully control for common artifacts including:

Potential ArtifactControl Strategy
Detergent-induced aggregationTest multiple detergents, validate with native membrane systems
Tag-mediated interactionsConfirm with reverse tagging and tag-free methods
Non-specific binding to hydrophobic regionsInclude appropriate negative controls (unrelated membrane proteins)
Overexpression artifactsValidate at physiological expression levels

This multi-faceted approach increases confidence in identified interactions while minimizing false positives common in membrane protein interaction studies .

What are the most significant knowledge gaps in current yneE protein research?

Despite progress in recombinant production and structural characterization of yneE protein, significant knowledge gaps persist that represent opportunities for impactful research:

  • Functional characterization: The fundamental biological role of yneE remains poorly understood. As a member of the UPF0187 family ("Uncharacterized Protein Family"), its physiological function requires systematic investigation through multiple complementary approaches .

  • Structural biology: While sequence analysis suggests membrane association, high-resolution structural data (X-ray crystallography, cryo-EM, or NMR) is lacking. This represents a critical gap limiting structure-function analyses .

  • Regulatory networks: The conditions governing yneE expression, potential post-translational modifications, and integration with broader cellular signaling networks remain largely unexplored .

  • Evolutionary conservation: Comparative analysis across bacterial species could provide insights into functional importance and potential specialized roles in different bacterial contexts .

  • Pathogenicity relevance: The potential contribution of yneE to bacterial pathogenesis, stress responses, or antibiotic resistance mechanisms represents an understudied area with potential translational implications .

Addressing these knowledge gaps requires integrated approaches combining genetic, biochemical, structural, and systems biology methodologies. Researchers entering this field should consider interdisciplinary collaborations to tackle these complex questions effectively .

How can researchers develop hypothesis-driven research programs focusing on yneE?

Developing a productive research program centered on yneE requires systematic hypothesis generation and testing strategies:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.