Recombinant Escherichia coli UPF0208 membrane protein YfbV (yfbV) is a protein that, in E. coli, is associated with the negative regulation of chromosome organization . The yfbV gene encodes this protein, which is also known by synonyms such as EcolC_1357 and UPF0208 membrane protein YfbV .
YfbV is a full-length protein consisting of 151 amino acids . The protein's amino acid sequence is: MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLCWQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVLAPVEGKPDYQALADTLKRAFKQLDKTFLDDL .
Recombinant YfbV protein is produced in E. coli and fused to an N-terminal His tag . It is available as a lyophilized powder . For reconstitution, deionized sterile water is recommended to achieve a concentration of 0.1-1.0 mg/mL . The addition of 5-50% glycerol is recommended for long-term storage at -20°C/-80°C . Repeated freezing and thawing should be avoided, and working aliquots should be stored at 4°C for up to one week .
KEGG: ecj:JW2292
STRING: 316385.ECDH10B_2457
UPF0208 membrane protein YfbV is a membrane-associated protein found in Escherichia coli. It belongs to the UPF0208 protein family, where "UPF" denotes "uncharacterized protein family," indicating that its precise biological function remains to be fully elucidated. The protein consists of 151 amino acids and is encoded by the yfbV gene. The significance of studying this protein lies in advancing our understanding of bacterial membrane biology, potentially uncovering novel membrane-associated functions, and contributing to the broader field of bacterial physiology. As a membrane protein, YfbV may play roles in cellular processes such as signal transduction, transport, or maintaining membrane integrity in E. coli, making it valuable for fundamental microbiological research .
The optimal conditions for expressing YfbV in E. coli require careful consideration of several parameters to maximize yield while maintaining protein functionality. Expression should be conducted using an appropriate E. coli strain such as BL21(DE3) or its derivatives, which lack certain proteases and are designed for high-level protein expression. The gene sequence should be codon-optimized for E. coli expression and preferably cloned into a pET-based vector under the control of the T7 promoter system for inducible expression . Induction is typically performed at mid-log phase (OD600 of 0.6-0.8) using IPTG at a concentration of 0.1-1.0 mM. Since YfbV is a membrane protein, lower induction temperatures (16-25°C) are often preferable to reduce the formation of inclusion bodies and facilitate proper membrane insertion. Additionally, the culture medium should be supplemented with appropriate antibiotics for plasmid maintenance and may benefit from the addition of membrane-stabilizing agents such as glycerol (2-5%) during expression . Expression levels should be monitored via SDS-PAGE and Western blotting to optimize induction time and harvesting conditions.
Purification of YfbV requires specialized techniques that address the hydrophobic nature and structural complexity of membrane proteins. The initial step involves careful membrane isolation through differential centrifugation followed by membrane solubilization using appropriate detergents such as n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin at concentrations above their critical micelle concentration. For affinity purification, the recombinant protein should contain an affinity tag (His-tag, FLAG-tag, etc.) positioned to minimize interference with protein folding and function . Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is commonly employed for His-tagged constructs, with washing buffers containing low concentrations of imidazole to reduce non-specific binding. Size exclusion chromatography serves as a critical polishing step to separate properly folded protein from aggregates and to exchange the protein into a final buffer with detergent concentrations just above the critical micelle concentration. For analytical assessment of purity, specialized electrophoretic techniques such as 16-BAC/SDS-PAGE can be more effective than conventional IEF/SDS-PAGE, as they enhance solubility and recovery of hydrophobic membrane proteins . Throughout the purification process, it is essential to maintain detergent concentrations above the critical micelle concentration to prevent protein aggregation.
The structure-function relationship of YfbV remains largely uncharacterized, presenting significant opportunities for novel research contributions. Based on sequence analysis, YfbV is predicted to contain multiple transmembrane helices typical of integral membrane proteins. The protein's amino acid sequence (MSTPDNRSVNFFSLFRRGQHYAKTWPMEKRLAPVFVENRVIRMTRYAIRFMPPVAVFTLCWQIALGGQLGPAVATALFALSLPMQGLWWLGKRSLTPLPPSILNWFYEVRGKLQEAGQALAPVEGKPDYQALADTLKRAFKQLDKTFLDDL) suggests the presence of hydrophobic regions interspersed with charged residues that may participate in specific interactions within the membrane environment or with partner proteins . The UPF0208 protein family is conserved across various bacterial species, indicating potential evolutionary importance despite the lack of clear functional annotation. Computational predictions suggest possible roles in small molecule transport, signal transduction, or membrane organization, but experimental validation is largely lacking. Research approaches combining site-directed mutagenesis with functional assays would be particularly valuable for establishing structure-function correlations. Comparative analysis with homologous proteins from related bacterial species might provide additional insights into conserved functional domains and species-specific adaptations.
For elucidating YfbV's membrane topology, a combination of complementary biophysical methods yields the most comprehensive characterization. Site-specific labeling techniques, such as substituted cysteine accessibility method (SCAM), can identify membrane-embedded versus solvent-exposed regions by introducing cysteine residues at strategic positions and assessing their reactivity with membrane-impermeable reagents. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides dynamic information about solvent-accessible regions and can delineate membrane-protected segments with minimal perturbation to protein structure . For higher resolution structural data, solid-state nuclear magnetic resonance (ssNMR) spectroscopy is particularly well-suited for membrane proteins and can provide atomic-level insights into orientation and dynamics within the lipid bilayer. Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology and can potentially resolve YfbV's three-dimensional structure in near-native environments using approaches such as single-particle analysis or tomography of two-dimensional crystals. Additionally, molecular dynamics simulations based on homology models can generate testable hypotheses about membrane interactions and conformational dynamics. When implementing these methods, researchers should consider the impact of detergent or lipid environment on protein conformation, as membrane composition can significantly influence topology and function of integral membrane proteins like YfbV.
Investigating protein-protein interactions involving YfbV requires specialized approaches that preserve the native membrane environment while enabling sensitive detection of interaction partners. Co-immunoprecipitation (Co-IP) using antibodies against YfbV or epitope tags incorporated into the recombinant protein can identify stable interaction partners when performed with membrane fractions solubilized in mild detergents that maintain protein complexes. For unbiased discovery of the YfbV interactome, proximity-labeling techniques such as BioID or APEX2 are particularly powerful; these methods involve fusing YfbV to an enzyme that biotinylates nearby proteins, allowing subsequent purification and identification of proximal proteins regardless of interaction strength . Bacterial two-hybrid systems adapted for membrane proteins can test specific interaction hypotheses in vivo while maintaining the membrane context. For quantitative assessment of interaction dynamics, microscale thermophoresis or biolayer interferometry with reconstituted proteoliposomes provides binding kinetics and affinities. Crosslinking mass spectrometry (XL-MS) can map interaction interfaces at the amino acid level by covalently linking proximal residues followed by proteolytic digestion and mass spectrometric analysis. When interpreting results from these studies, it is essential to validate interactions through multiple methodologies and to consider that membrane protein interactions may be influenced by lipid composition or detergent selection during experimental procedures.
Studying YfbV interactions with the lipid bilayer requires specialized techniques that preserve the native membrane environment while providing detailed molecular insights. Fluorescence spectroscopy using intrinsic tryptophan fluorescence or site-specific labeling with environment-sensitive fluorophores can detect conformational changes upon interaction with different lipid compositions. Attenuated total reflection Fourier-transform infrared spectroscopy (ATR-FTIR) is particularly valuable for determining the orientation of transmembrane segments relative to the membrane plane. Langmuir monolayer techniques can assess the protein's ability to insert into lipid films and measure the resulting changes in surface pressure. For direct visualization of YfbV-lipid interactions, atomic force microscopy (AFM) of reconstituted proteoliposomes or supported bilayers provides nanoscale topographical information and mechanical properties of the protein-membrane complex . Deuterium solid-state NMR of selectively deuterated lipids in the presence of YfbV can reveal how the protein affects lipid acyl chain ordering and dynamics. Additionally, native mass spectrometry has emerged as a powerful tool for identifying specific lipids that co-purify with membrane proteins, potentially indicating preferential interactions. When designing these experiments, researchers should systematically vary lipid composition, including headgroup chemistry, acyl chain length, and saturation, to identify specific lipid requirements for YfbV folding, stability, or function.
Overcoming the challenges of expressing and purifying sufficient quantities of functional YfbV requires a multi-faceted strategy addressing several key bottlenecks. First, expression vector optimization should include careful selection of promoter strength, codon usage adjustment, and incorporation of translation-enhancing elements such as optimized Shine-Dalgarno sequences. Utilizing specialized E. coli strains such as C41(DE3) or C43(DE3), which have adaptations for membrane protein overexpression, can significantly improve yields. Co-expression of molecular chaperones (GroEL/GroES, DnaK/DnaJ) may prevent misfolding and aggregation during synthesis . For membrane integration, controlled induction parameters are critical—lower temperatures (16-18°C), reduced inducer concentrations, and extended expression times often favor proper folding over rapid accumulation. During purification, the choice of detergent is paramount; beginning with a panel of detergents (including novel amphipols or nanodisc technologies) can identify optimal solubilization conditions that preserve native structure. Implementing high-throughput screening approaches to simultaneously test multiple expression and purification conditions can efficiently identify optimal parameters. For proteins prone to aggregate formation, recent research suggests that controlled inclusion body formation followed by specialized refolding protocols may actually yield higher amounts of functional protein than direct soluble expression attempts . Additionally, exploring cell-free expression systems, which allow direct synthesis into artificial membranes or detergent micelles, can circumvent cellular toxicity issues that often limit membrane protein yields in vivo.
For effective analysis of YfbV and other membrane proteins, specialized electrophoretic techniques that address the unique properties of these hydrophobic molecules are essential. The 16-BAC/SDS-PAGE two-dimensional electrophoretic method represents a significant advancement over conventional IEF/SDS-PAGE for membrane proteins. This technique utilizes the cationic detergent benzyldimethyl-n-hexadecylammonium chloride (16-BAC) in the first dimension, creating a low-pH environment that enhances solubility and recovery of highly hydrophobic membrane proteins, while preserving unstable methylation of basic proteins . In the second dimension, standard SDS-PAGE provides separation based on molecular weight. This approach has proven successful for analyzing membrane proteins from various sources, including mitochondria and parasite-infected erythrocytes. Blue native PAGE (BN-PAGE) offers an alternative approach that maintains native protein-protein interactions, making it valuable for studying YfbV in its natural complex associations. Clear native PAGE (CN-PAGE) provides similar benefits without the potential interference of Coomassie dye binding. For highest resolution analysis of YfbV oligomeric states, perfluorooctanoic acid PAGE (PFO-PAGE) can separate membrane protein complexes while preserving quaternary structure. When implementing these techniques, sample preparation is crucial—complete solubilization without denaturation requires careful optimization of detergent type, concentration, and temperature, often necessitating pre-heating of samples at temperatures below conventional denaturation protocols (e.g., 37°C instead of 95°C) to prevent aggregation.
Working with YfbV presents several common pitfalls that can significantly impact research outcomes if not properly addressed. One of the most frequent challenges is low expression yields resulting from protein toxicity to the host organism. This can be mitigated by using tightly controlled inducible expression systems, reducing induction temperature to 16-18°C, and utilizing specialized E. coli strains designed for toxic protein expression such as C41(DE3) or Lemo21(DE3), which provide tunable expression levels . Another common issue is protein aggregation during membrane extraction and purification. This can be addressed by screening multiple detergents at various concentrations, implementing on-column detergent exchange protocols, and adding stabilizing agents such as glycerol or specific lipids to purification buffers. Proteolytic degradation, particularly common with membrane proteins, can be minimized by including a cocktail of protease inhibitors throughout purification and working at reduced temperatures. Loss of function during purification often occurs due to delipidation of essential lipids; this can be prevented by purifying in the presence of lipid mixtures that mimic the native membrane environment or by reconstituting the protein into nanodiscs or liposomes immediately after purification. For analytical challenges, conventional protein quantification methods like Bradford assays can give inaccurate results with detergent-solubilized membrane proteins; alternative approaches such as amino acid analysis or absorbance at 280 nm with experimentally determined extinction coefficients provide more reliable quantification.
Optimizing buffer conditions for maximum stability of purified YfbV requires systematic evaluation of multiple parameters affecting membrane protein stability. Begin with a buffer screening approach testing various pH ranges (typically 6.0-8.5), buffer systems (HEPES, Tris, phosphate, MES), and ionic strengths (50-500 mM). For membrane proteins like YfbV, detergent selection is critical—conduct a detergent screen including maltoside-based (DDM, UDM), glucoside-based (OG, NG), and newer detergents like GDN or LMNG, which often provide superior stability for membrane proteins. Implement thermal shift assays using differential scanning fluorimetry to quantitatively assess protein stability under each condition . Additives can dramatically improve stability—test glycerol (5-20%), specific lipids (particularly E. coli lipid extract or defined phospholipids), cholesterol hemisuccinate, and osmolytes such as sucrose or trehalose. The addition of specific metal ions (Mg2+, Ca2+, Zn2+) at 1-5 mM may stabilize certain structural features. For long-term storage, evaluate cryoprotectant combinations and optimal protein concentrations, as concentration-dependent aggregation is common with membrane proteins. Consider advanced stabilization approaches such as conformational fixing through ligands (if known) or engineered disulfide bonds. Throughout this optimization process, it is essential to verify that stabilizing conditions do not compromise functional activity, which should be assessed using appropriate functional assays after each stabilization step.
Addressing protein aggregation and inclusion body formation during YfbV expression requires strategies targeting multiple stages of the expression process. At the genetic level, optimizing codon usage for balanced expression rate rather than maximum speed can allow proper membrane insertion to keep pace with translation. Incorporating fusion partners such as MBP (maltose-binding protein) or SUMO at the N-terminus can enhance solubility, provided that cleavage sites are engineered for subsequent removal . Modulating expression temperatures is crucial—initiating culture growth at 37°C but shifting to 16-18°C prior to induction provides optimal conditions for membrane protein folding while maintaining reasonable cell growth. The inducer concentration should be carefully titrated, as lower concentrations (0.01-0.1 mM IPTG) often favor proper folding over high expression levels that lead to aggregation. For strains utilizing the T7 expression system, co-expression of T7 lysozyme from pLysS or pLysE plasmids provides tighter control of basal expression, preventing premature accumulation and aggregation . If inclusion bodies still form despite these preventative measures, recent research suggests two viable recovery approaches: (1) in vitro refolding protocols specifically developed for membrane proteins, utilizing a stepwise detergent exchange method from strong denaturing detergents (SDS) to milder ones (DDM), or (2) solubilizing inclusion bodies in urea or guanidinium chloride followed by rapid dilution into detergent-lipid mixed micelles. Both approaches have demonstrated success in recovering functional membrane proteins from aggregated states, though optimization is typically required for each specific protein.
Utilizing recombinant YfbV in structural biology studies requires strategic planning across sample preparation, data collection, and structure determination phases. For X-ray crystallography, purified YfbV should be screened in various detergents that support crystallization, with particular attention to detergents with small micelles such as octyl glucoside or LDAO. Lipidic cubic phase (LCP) crystallization represents an alternative approach that mimics the native membrane environment and has proven successful for many challenging membrane proteins . For cryo-electron microscopy (cryo-EM), reconstitution into nanodiscs composed of MSP (membrane scaffold protein) and defined lipids provides a more native-like environment than detergent micelles while offering greater particle size for alignment algorithms. Sample vitrification conditions must be optimized to achieve thin ice without preferential orientation of the membrane protein. For nuclear magnetic resonance (NMR) studies, isotopic labeling strategies are essential—uniform 15N/13C labeling for backbone assignments, selective amino acid labeling for specific interaction studies, and deuteration to reduce spectral complexity. Solid-state NMR approaches with YfbV reconstituted into oriented bilayers can provide valuable information on transmembrane domain topology and dynamics. Throughout structural studies, protein stability should be continuously monitored, as membrane proteins are particularly susceptible to time-dependent aggregation. Integrating computational approaches such as molecular dynamics simulations with experimental structural data can provide insights into conformational dynamics that may not be captured in static structures, particularly for flexible regions or alternative conformational states.
Current hypotheses regarding YfbV function stem from comprehensive bioinformatic analyses despite limited experimental characterization. Sequence analysis reveals that YfbV belongs to the UPF0208 protein family, which is conserved across multiple bacterial species, suggesting an important biological role . Structural prediction algorithms indicate multiple transmembrane helices interspersed with short loops, typical of channels, transporters, or signal transduction components. The presence of conserved charged residues in predicted transmembrane regions may indicate involvement in ion conduction or substrate recognition. Genomic context analysis across bacterial species shows that yfbV often clusters with genes involved in stress response or membrane integrity maintenance, suggesting potential roles in environmental adaptation or membrane homeostasis. Phylogenetic profiling indicates co-evolution with specific metabolic pathways in some bacterial lineages, potentially linking YfbV to specialized metabolic functions. Protein-protein interaction predictions based on co-expression data and evolutionary coupling analysis suggest associations with components of the cell division machinery in some organisms. The most compelling current hypothesis, supported by multiple bioinformatic approaches, positions YfbV as either a small molecule transporter with specificity determined by the variable regions across species, or as a component of stress response systems that maintains membrane integrity under adverse conditions. These hypotheses represent valuable starting points for directed experimental investigations, particularly through targeted mutagenesis of conserved residues combined with functional assays.
Designing experiments to elucidate the physiological role of YfbV in E. coli requires a multi-faceted approach combining genetic, biochemical, and physiological methods. Begin with precise gene deletion using CRISPR-Cas9 or λ-Red recombination to generate a clean yfbV knockout strain, complemented with controlled expression constructs for validation. Phenotypic characterization should include growth curves under various stress conditions (osmotic shock, pH stress, temperature variation, nutrient limitation) to identify conditions where YfbV becomes essential or advantageous. High-throughput phenotype microarrays such as Biolog plates can systematically screen hundreds of growth conditions simultaneously to identify specific metabolic pathways affected by YfbV absence. Transcriptome analysis comparing wild-type and ΔyfbV strains under standard and stress conditions can reveal compensatory changes and pathway associations. For in vivo localization, fluorescent protein fusions or immunogold electron microscopy can determine subcellular distribution patterns and potential co-localization with known membrane complexes. Membrane integrity and potential can be assessed using fluorescent dyes such as DiBAC4(3) or propidium iodide to detect changes in ΔyfbV strains. Metabolomic profiling may identify accumulated or depleted metabolites suggestive of transport functions. To detect potential interaction partners, in vivo crosslinking followed by mass spectrometry can capture transient protein-protein interactions within the native membrane. These approaches should be integrated with structural and biochemical data from purified protein studies to develop and test specific mechanistic hypotheses about YfbV function in bacterial physiology.
When selecting an expression system for recombinant YfbV production, researchers should consider both yield and downstream requirements for functional studies. The following table summarizes the characteristics of different expression systems for YfbV production based on current research findings:
| Expression System | Relative Yield | Turnaround Time | Post-translational Modifications | Advantages | Limitations |
|---|---|---|---|---|---|
| E. coli | High | 2-3 days | Minimal | Cost-effective, well-established protocols, easily scalable | Limited post-translational modifications, potential inclusion body formation |
| Yeast (P. pastoris) | Moderate-High | 7-10 days | Partial glycosylation, some disulfide bond formation | Higher eukaryotic folding machinery, secretion possible | More complex media requirements, longer optimization time |
| Insect cells (Baculovirus) | Moderate | 10-14 days | Near-complete eukaryotic modifications | Good for complex membrane proteins, native-like membrane environment | Higher cost, specialized equipment needed, longer expression time |
| Mammalian cells | Low-Moderate | 14-21 days | Complete eukaryotic modifications | Most native-like folding environment | Highest cost, lowest yields, longest production time |
| Cell-free systems | Variable | 1-2 days | Depends on lysate source | Rapid, avoids toxicity issues, direct incorporation into artificial membranes | Higher cost per mg protein, limited scalability |
The selection of appropriate detergents is critical for successful solubilization and purification of membrane proteins like YfbV. The following table compiles research findings on detergent effectiveness for membrane protein work, with implications for YfbV purification:
| Detergent | Critical Micelle Concentration (mM) | Micelle Size (kDa) | Solubilization Efficiency | Protein Stability | Recommended Applications |
|---|---|---|---|---|---|
| n-Dodecyl-β-D-maltoside (DDM) | 0.17 | 70 | High | Excellent | Initial solubilization, long-term storage, crystallization trials |
| n-Octyl-β-D-glucopyranoside (OG) | 23 | 25 | Moderate | Moderate | Crystallization, NMR studies (small micelle) |
| Lauryl maltose neopentyl glycol (LMNG) | 0.01 | 90 | High | Exceptional | Long-term stability studies, cryo-EM sample preparation |
| Digitonin | 0.5 | 70 | Moderate | Very good | Preserving protein-protein interactions, cryo-EM |
| Triton X-100 | 0.23 | 90 | High | Good | Initial screening, not suitable for spectroscopic studies |
| CHAPSO | 8 | 7 | Moderate | Good | NMR studies, crystallization trials |
| Sodium dodecyl sulfate (SDS) | 8.2 | 18 | Very high | Poor (denaturing) | Analytical applications only (SDS-PAGE) |
| Amphipols (A8-35) | N/A | Variable | N/A (requires pre-solubilization) | Excellent | Cryo-EM, enhancing stability after purification |
For YfbV purification, a recommended strategy involves initial solubilization with DDM at a concentration of 1% (w/v), followed by purification in buffers containing 0.05% DDM . For applications requiring smaller micelle size, detergent exchange to OG or CHAPSO can be performed during later purification steps. Novel detergents such as LMNG offer superior stability for long-term studies or when multiple freeze-thaw cycles are anticipated. For structural studies, particularly cryo-EM, amphipols or nanodisc reconstitution after initial detergent purification can provide a more native-like environment. When working with any detergent, it is critical to maintain concentrations above the critical micelle concentration throughout all purification steps to prevent protein aggregation.
Research proposals involving recombinant protein studies such as those focused on YfbV must comply with specific NIH data table requirements, particularly for training grant applications. The following table outlines the essential NIH data tables and their specific requirements for recombinant protein research proposals:
| Table Number | Title | Required Content for YfbV Research | Application Type | Submission Deadline Requirements |
|---|---|---|---|---|
| Table 1 | Census of Participating Departments or Interdepartmental Programs | Complete Part I (Predoctorates) only for programs focused on predoctoral training | New and Renewal Applications | All columns except last 2 for new applications |
| Table 2 | Participating Faculty Members | List all faculty with expertise in membrane protein expression and structural biology | New and Renewal Applications | Complete table for both application types |
| Table 3 | Federal Organizational Research Training Grant and Related Support Available to Participating Faculty Members | Include all grants related to membrane protein research and structural biology | New and Renewal Applications | Complete table for both application types |
| Table 4 | Active Research Support of Participating Faculty Members | Detail current funding supporting recombinant protein work, including YfbV or related membrane proteins | New and Renewal Applications | Complete table for both application types |
| Table 5A | Publications of Trainees Supported by this Program: Predoctoral | Include all publications related to recombinant protein expression and characterization | New and Renewal Applications | Complete table for both application types |
| Table 6A | Training Program Candidates, Entrants, and Their Characteristics for the Past Five Years: Predoctoral | Document trainee experience with recombinant membrane protein systems | New and Renewal Applications | Must be included for due dates on/after May 25, 2025 |
| Table 7 | Appointments to the Training Grant for Each Year of the Current Project Period | Document prior trainee appointments involved in recombinant protein work | Renewal Applications Only | Not applicable for new applications |
| Table 8A | Program Outcomes: Predoctoral | For new applications: Part II only (Recent Graduates); For renewals: Parts I and III | New and Renewal Applications | Complete as specified for application type |
When preparing NIH applications focusing on YfbV research, investigators must combine Tables 1-6 & 8 (for new applications) or Tables 1-8 (for renewal applications) into a single document and upload to "Section 9: Data Tables" of the PHS 398 Research Training Program Plan Forms I . For proposals submitted in 2025, particular attention should be paid to Table 6A, which becomes mandatory for all applications with due dates on or after May 25, 2025 . These tables must comprehensively demonstrate the research environment's capacity to support advanced membrane protein studies, including appropriate expertise, equipment, and successful training outcomes in similar complex protein systems.