Recombinant Escherichia coli UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Description

Functional Insights and Research Findings

Postulated Roles

  • Membrane Insertion: Homology to YidC suggests potential involvement in co-translational membrane protein insertion, though direct evidence is lacking .

  • Metal Ion Binding: Structural pockets in homologs (e.g., B. subtilis YciC) imply roles in zinc homeostasis or metallochaperone activity .

  • Stress Response: Upregulated under zinc limitation in related species, suggesting a stress-adaptation role .

Key Studies

  • B. subtilis homolog studies reveal YciC is regulated by Zur (zinc uptake regulator) and associates with ribosomal proteins under zinc-deficient conditions .

  • E. coli YciC’s abundance in membrane extracts hints at involvement in membrane protein complex assembly or metal trafficking .

Applications in Research

  • Antibody Development: Used as an antigen for polyclonal antibody production .

  • Structural Biology: Candidate for crystallization trials to resolve its membrane interaction mechanisms .

  • Metalloprotein Studies: Investigated for potential roles in bacterial metal ion homeostasis .

Challenges and Future Directions

  • Functional Characterization: Limited experimental data directly linking E. coli YciC to specific biochemical pathways.

  • Structural Resolution: High-resolution structural studies (e.g., cryo-EM) are needed to elucidate substrate-binding sites .

  • Biotechnological Potential: Exploration in recombinant protein production systems to mitigate metabolic burden in E. coli hosts .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have specific format requirements, please include them in your order notes. We will accommodate your needs whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
The shelf life of the product depends on multiple factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type will be determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
yciC; ECSE_1304; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli (strain SE11)
Target Names
yciC
Target Protein Sequence
MSITAQSVYRDTGNFFRNQFMTILLVSLLCAFITVVLGHVFSPSDAQLAQLNDGVPVSGS SGLFDLVQNMSPEQQQILLQASAASTFSGLIGNAILAGGVILIIQLVSAGQRVSALRAIG ASAPILPKLFILIFLTTLLVQIGIMLVVVPGIIMAILLALAPVMLVQDKMGIFASMRSSM RLTWANMRLVAPAVLSWLLAKTLLLLFASSFAALTPEIGAVLANTLSNLISAILLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0259 membrane protein YciC in Escherichia coli?

UPF0259 membrane protein YciC is a membrane-associated protein found in Escherichia coli. It belongs to the uncharacterized protein family UPF0259, as evidenced by its InterPro domain classification. The protein consists of 247 amino acids in E. coli strain SE11 and forms a transmembrane structure integrated into the bacterial cell membrane . Despite being identified and sequenced, the precise biological function of YciC remains largely uncharacterized, making it an interesting target for structural and functional studies in bacterial membrane biology. The protein contains multiple predicted transmembrane domains that anchor it within the bacterial membrane system.

How does YciC fit within the broader context of membrane protein biology?

YciC represents one of the thousands of membrane proteins that play crucial roles in cellular functions. While its specific function remains to be fully elucidated, YciC exemplifies the challenges in membrane protein research as part of the approximately 5% of eukaryotic proteomes consisting of membrane-associated proteins . Within membrane protein classification, YciC belongs to the category of transmembrane proteins that are inserted into the membrane via complex biogenesis pathways involving protein-conducting channels such as SecY/Sec61.

The protein exists within the complex bacterial membrane environment where, like other membrane proteins, its function is likely influenced by lipid-protein interactions and membrane architecture. Understanding YciC contributes to the broader field of membrane protein biology, which has seen significant advances in structural determination methods, with over 1,198 unique membrane protein structures elucidated as of early 2021 .

What expression systems are optimal for recombinant production of YciC?

For the recombinant production of E. coli UPF0259 membrane protein YciC, several expression systems have been employed with varying success rates. Based on research protocols, the following expression systems can be considered:

Expression SystemAdvantagesChallengesYield Optimization
E. coli- Native environment
- Rapid growth
- Cost-effective
- Well-established protocols
- Potential toxicity
- Inclusion body formation
- Use of C41/C43 strains
- Lower induction temperatures (16-25°C)
- Controlled induction with 0.1-0.5 mM IPTG
Yeast- Post-translational modifications
- Eukaryotic folding machinery
- Different membrane composition
- Lower expression levels
- Codon optimization
- Use of strong inducible promoters
- Selection of appropriate strain
Baculovirus- High expression levels
- Superior folding for complex proteins
- Time-consuming
- Higher cost
- Technical complexity
- Optimize MOI
- Harvest timing optimization
- Addition of chaperones
Mammalian Cell- Native-like folding
- Complete post-translational modifications
- Highest cost
- Slowest growth
- Complex media requirements
- Stable cell line development
- Tetracycline-inducible systems
- Optimized transfection protocols

As indicated in the source material, YciC has been successfully produced in E. coli, yeast, baculovirus, or mammalian cell expression systems . The choice depends on research goals, with E. coli often preferred for structural studies requiring high yields, while mammalian systems might be favored when functional authenticity is paramount.

What purification strategies are most effective for obtaining high-purity YciC protein?

Purification of the YciC membrane protein requires specialized approaches to maintain protein stability and function. An effective methodological workflow includes:

  • Membrane Extraction: Solubilization of cell membranes containing YciC using optimized detergent mixtures (typically 1-2% DDM, LMNG, or C12E8) in buffer systems maintained at pH 7.4-8.0 with 100-300 mM NaCl and 5-10% glycerol as stabilizers.

  • Affinity Chromatography: Implementation of immobilized metal affinity chromatography (IMAC) using His-tagged YciC constructs with imidazole gradient elution (20-300 mM). Critical washing steps with 40-60 mM imidazole remove non-specific binding proteins.

  • Size Exclusion Chromatography: Separation of monomeric from aggregated protein using Superdex 200 or similar matrices, with continuous detergent presence (typically 2-3× CMC) in the mobile phase.

  • Ion Exchange Chromatography: Optional polishing step using anion exchange (Q-Sepharose) at pH 8.0 or cation exchange (SP-Sepharose) depending on the calculated pI of YciC.

The purification success can be monitored through SDS-PAGE analysis combined with Western blotting using anti-His antibodies. Purity levels exceeding 95% are typically required for structural studies, while functional assays may proceed with >90% purity.

How can researchers verify the proper folding and membrane insertion of recombinant YciC?

Verifying proper folding and membrane insertion of recombinant YciC requires multiple complementary analytical approaches:

  • Circular Dichroism (CD) Spectroscopy: Analysis of secondary structure content by far-UV CD (190-260 nm) to confirm alpha-helical content characteristic of membrane proteins. YciC, with its predicted transmembrane domains, should display characteristic negative peaks at 208 and 222 nm indicative of alpha-helical structures.

  • Tryptophan Fluorescence Spectroscopy: Measurement of intrinsic fluorescence to assess tertiary structure integrity. Properly folded YciC would show distinct emission maxima depending on the local environment of tryptophan residues, with blue-shifted emission (around 330-340 nm) indicating burial in hydrophobic environments.

  • Protease Protection Assays: Selective digestion of accessible protein regions using proteases like trypsin or chymotrypsin followed by mass spectrometry analysis to map protected transmembrane domains.

  • Membrane Reconstitution Studies: Incorporation of purified YciC into liposomes or nanodiscs followed by density gradient centrifugation to confirm membrane association.

  • Limited Proteolysis Combined with Mass Spectrometry: Identification of flexible regions versus stable domains by time-course proteolytic degradation, providing insights into structural organization.

These methodological approaches collectively provide robust evidence for proper folding and membrane integration, essential validation steps before proceeding to functional or structural studies.

What experimental approaches can determine the biological function of YciC?

Determining the biological function of the poorly characterized YciC protein requires a multi-faceted experimental approach:

  • Genetic Knockout Studies: Creation of ΔyciC strains in E. coli using CRISPR-Cas9 or homologous recombination techniques, followed by comprehensive phenotypic characterization including:

    • Growth curve analysis under various conditions (temperature, pH, osmotic stress)

    • Membrane integrity assessment using fluorescent dyes

    • Metabolomic profiling to identify altered metabolic pathways

  • Protein Interaction Networks: Identification of YciC interaction partners through:

    • Co-immunoprecipitation with tagged YciC followed by mass spectrometry

    • Bacterial two-hybrid screening

    • Proximity labeling approaches (BioID or APEX2 fusions)

    • Crosslinking mass spectrometry (XL-MS) to identify transient interactions

  • Localization Studies: Determination of subcellular localization using:

    • Immunofluorescence microscopy with anti-YciC antibodies

    • Fluorescent protein fusions (ensuring functionality is maintained)

    • Fractionation studies with Western blot verification

  • Structural Biology Integration: Leveraging structural insights to inform functional hypotheses:

    • Identification of conserved domains or motifs

    • Structure-guided mutagenesis of predicted functional residues

    • Molecular docking with potential ligands/substrates

  • Bioinformatic Analysis: Comprehensive computational prediction including:

    • Phylogenetic profiling across bacterial species

    • Gene neighborhood and co-occurrence analysis

    • Structural modeling and comparison with functionally characterized membrane proteins

Each approach generates complementary data points that, when integrated, can provide compelling evidence for YciC's biological function.

How can membrane protein translocation be studied in the context of YciC?

Studying membrane protein translocation mechanisms for YciC requires specialized techniques that address the complexity of membrane insertion processes:

  • In Vitro Translation-Translocation Assays: Reconstitution of the translocation process using:

    • Purified components (SecYEG/Sec61 complex, YciC mRNA, ribosomes, and necessary chaperones)

    • Detection of membrane insertion via protease protection assays

    • Analysis of insertion kinetics through time-course experiments

    • Quantification using radiolabeled amino acids or fluorescent labeling

  • Crosslinking Studies: Capture of transient interactions during translocation:

    • Site-specific incorporation of photoreactive crosslinkers at strategic positions in YciC

    • UV-activation at different stages of translation/translocation

    • Identification of crosslinked partners by mass spectrometry

    • Mapping the translocation pathway through sequential crosslinking

  • Force Microscopy Approaches: Direct measurement of insertion forces:

    • Optical tweezers or magnetic tweezers setups

    • Single-molecule FRET to monitor conformational changes during insertion

    • Force spectroscopy to quantify energy barriers in the insertion process

  • Real-time Fluorescence Microscopy: Visualization of the insertion process:

    • N-terminal and C-terminal fluorescent protein fusions to track membrane integration

    • Dual-color labeling to distinguish cytoplasmic and periplasmic domains

    • FRAP (Fluorescence Recovery After Photobleaching) to measure lateral mobility post-insertion

These methodologies align with our understanding of membrane protein biogenesis pathways, where proteins such as YciC would likely follow insertion mechanisms involving the SecY/Sec61 translocon described in the literature . The "positive inside" rule for transmembrane orientation established by Sipos and von Heijne would provide a framework for predicting YciC's membrane topology during insertion studies.

What are the implications of YciC's sequence conservation across bacterial species?

Sequence conservation analysis of YciC across bacterial species provides valuable insights into its evolutionary significance and potential functional importance:

  • Phylogenetic Distribution: YciC homologs are found predominantly in Gram-negative bacteria, with highest conservation among Enterobacteriaceae. This restricted distribution suggests a specialized function potentially related to the unique dual-membrane architecture of Gram-negative bacteria.

  • Conservation of Transmembrane Domains: Multiple sequence alignment reveals that the predicted transmembrane domains show higher conservation than loop regions, suggesting functional constraints on membrane-spanning segments. This pattern is consistent with other membrane proteins where the membrane-embedded regions maintain structural integrity while exposed loops evolve more rapidly.

  • Identification of Invariant Residues: Several absolutely conserved residues exist across YciC homologs, including:

    • Charged residues within transmembrane domains (unusual and likely functionally significant)

    • Potential metal-binding motifs that may indicate interaction with cofactors

    • Conserved proline residues that may introduce kinks important for structural flexibility

  • Co-evolution Analysis: Statistical coupling analysis (SCA) and direct coupling analysis (DCA) of YciC sequences reveals networks of co-evolving residues that likely form functional sectors within the protein structure, providing clues to mechanistic aspects of its function.

  • Gene Neighborhood Conservation: Analysis of genomic context across species shows YciC frequently co-occurs with genes involved in specific cellular processes, suggesting functional associations through:

    • Operonic arrangements with genes of known function

    • Conserved gene neighborhoods that indicate functional relationships

    • Co-regulation patterns under specific stress conditions

This evolutionary conservation analysis guides hypothesis formation about YciC's biological role and directs experimental design for functional characterization.

What structural prediction methods are most reliable for transmembrane proteins like YciC?

Structural prediction of transmembrane proteins presents unique challenges due to their hydrophobic nature and membrane environment. For YciC, a methodical approach combining multiple prediction tools yields the most reliable results:

  • Transmembrane Topology Prediction:

    • TMHMM, HMMTOP, and Phobius provide predictions based on hydrophobicity analysis and the positive-inside rule

    • TOPCONS integrates multiple prediction methods to generate consensus topology

    • MEMSAT-SVM incorporates support vector machines for improved accuracy

    For YciC specifically, these tools predict multiple transmembrane helices with cytoplasmic and periplasmic loops, consistent with its classification as a membrane protein.

  • Advanced Structure Prediction Pipelines:

    • AlphaFold2 has revolutionized protein structure prediction and performs well for membrane proteins

    • RoseTTAFold leverages deep learning for accurate structure prediction

    • MEMOIR specifically optimized for membrane protein modeling

    These methods can generate three-dimensional models of YciC with estimated per-residue confidence scores.

  • Homology Modeling Considerations:

    • HHpred for sensitive detection of remote homologs

    • MODELLER for template-based modeling when structural homologs exist

    • SWISS-MODEL automated pipeline with membrane protein-specific assessment

  • Model Validation for Membrane Context:

    • MEMOIR-VMD plugin for assessment of membrane protein models

    • ProQM specifically designed for membrane protein model quality

    • QMEANBrane for context-specific quality estimation

  • Molecular Dynamics Refinement:

    • CHARMM-GUI Membrane Builder for embedding predicted structures in lipid bilayers

    • Martini coarse-grained simulations for efficient refinement

    • All-atom MD simulations with explicit membrane and solvent

These methods should be applied in a hierarchical manner, beginning with topology prediction, followed by three-dimensional structure generation, and finally membrane-context refinement and validation to generate the most reliable structural models of YciC.

How can researchers study YciC's interactions with the lipid bilayer?

Studying YciC's interactions with the lipid bilayer requires specialized techniques that capture the dynamic protein-lipid interface:

  • Site-Directed Spin Labeling (SDSL) with Electron Paramagnetic Resonance (EPR):

    • Strategic introduction of cysteine residues for spin label attachment

    • Measurement of accessibility parameters in different membrane environments

    • Determination of immersion depth through power saturation experiments

    • Collection of distance measurements between labeled sites to map protein topology

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Differential exchange rates identify membrane-protected regions

    • Time-course experiments reveal dynamics of membrane interactions

    • Comparison of exchange patterns in different lipid compositions

    • Integration with computational models to map lipid-accessible surfaces

  • Fluorescence Techniques:

    • Tryptophan fluorescence quenching by brominated lipids

    • Förster Resonance Energy Transfer (FRET) between protein and labeled lipids

    • Fluorescence correlation spectroscopy (FCS) to measure diffusion coefficients

    • Fluorescence anisotropy to detect changes in protein mobility

  • Native Mass Spectrometry:

    • Detection of specifically bound lipids that co-purify with YciC

    • Identification of lipid binding specificity through competition experiments

    • Quantification of binding affinities for different lipid species

    • Mapping of lipid binding sites through mutagenesis studies

  • Molecular Dynamics Simulations:

    • All-atom simulations to identify stable protein-lipid interactions

    • Analysis of lipid enrichment/depletion around specific protein domains

    • Calculation of free energy profiles for lipid binding

    • Prediction of membrane deformation induced by protein insertion

These experimental approaches provide complementary data on how YciC interacts with and potentially modifies the surrounding lipid environment, which is essential for understanding its membrane integration and function.

What role might YciC play in membrane protein biogenesis pathways?

Given the context of membrane protein biogenesis literature, YciC could potentially participate in several aspects of membrane protein insertion and assembly:

  • Potential Roles in the SecY/Sec61 Pathway:
    YciC may function as an accessory factor in the main secretion/insertion pathway, similar to other membrane proteins that associate with the SecY/Sec61 translocon . Such accessory factors often:

    • Facilitate lateral release of transmembrane domains

    • Assist in the proper folding of complex membrane proteins

    • Contribute to quality control mechanisms during insertion

    • Help establish correct topology of multi-pass membrane proteins

  • Possible Function in Alternative Insertion Pathways:
    YciC's structure might suggest similarity to the YidC/Oxa1/Alb3 superfamily members that insert proteins into membranes outside the main Sec pathway . This could indicate:

    • Specialized insertion activity for a subset of membrane proteins

    • Formation of membrane-thinning regions to facilitate insertion

    • Creation of a hydrophilic environment to assist in translocation

    • Participation in the formation of protein-conducting channels

  • Potential Chaperone Activity:
    YciC might function similarly to components of the EMC (ER Membrane Complex), which serves as both an insertase and a holdase-chaperone for complex transmembrane proteins :

    • Stabilization of transmembrane domains during membrane insertion

    • Prevention of misfolding through direct interactions with client proteins

    • Facilitation of proper assembly of multi-subunit membrane complexes

    • Recruitment of additional factors required for complete folding

  • Possible Role in Stress Response:
    YciC could be involved in maintaining membrane integrity during stress conditions:

    • Modulation of membrane fluidity or composition

    • Stabilization of essential membrane proteins

    • Participation in stress-induced remodeling of membrane architecture

    • Sensing of membrane perturbations and signaling to stress response pathways

Understanding YciC's potential involvement in these processes requires investigations that compare its structure and behavior to known components of membrane protein biogenesis pathways, combined with functional studies that examine membrane protein insertion and folding in YciC-depleted or overexpression conditions.

How can structural studies of YciC contribute to membrane protein research methodologies?

Structural studies of YciC have the potential to advance membrane protein research methodologies in several significant ways:

  • Method Development for Challenging Membrane Proteins:
    YciC represents a class of poorly characterized membrane proteins that pose significant challenges for structural biology. Successful structural determination would:

    • Validate new solubilization strategies applicable to similar proteins

    • Establish optimized crystallization conditions for membrane proteins with similar characteristics

    • Develop improved sample preparation protocols for cryo-EM studies of small membrane proteins

    • Refine computational approaches for predicting structures of uncharacterized membrane proteins

  • Advancement of Hybrid Methodological Approaches:
    Combining multiple structural techniques for YciC characterization would demonstrate effective integration of:

    • Solid-state NMR for membrane-embedded domains

    • Solution NMR for flexible loop regions

    • X-ray crystallography for high-resolution static information

    • Cryo-EM for capturing different conformational states

    • Integrative modeling to synthesize diverse experimental constraints

  • Development of Membrane Mimetics:
    YciC studies could pioneer novel membrane mimetics that better replicate native environments:

    • Optimization of nanodisc compositions for specific membrane proteins

    • Development of new detergent/lipid mixtures that maintain native-like conditions

    • Testing of polymer-based systems like SMALPs (Styrene Maleic Acid Lipid Particles) for extracting proteins with surrounding native lipids

    • Comparison of protein behavior across different mimetic systems

  • Refinement of Computational Protocols:
    Structural characterization of YciC would provide valuable data for:

    • Benchmarking prediction algorithms against experimental structures

    • Refining force fields for membrane protein molecular dynamics

    • Improving docking approaches for membrane protein complexes

    • Enhancing deep learning approaches trained on membrane protein datasets

These methodological advancements would extend beyond YciC to benefit research on numerous other challenging membrane proteins, potentially accelerating discoveries across the field of membrane protein biology.

What are the potential therapeutic implications of understanding YciC structure and function?

Understanding YciC's structure and function could open several avenues for therapeutic development, particularly in the context of bacterial infections:

  • Novel Antibiotic Development:
    If YciC proves essential for bacterial viability or virulence, it could serve as a target for new antibiotics:

    • Structure-based drug design targeting unique structural features of YciC

    • High-throughput screening for compounds that specifically bind YciC

    • Peptide inhibitors designed to disrupt YciC interactions with partner proteins

    • Small molecules that interfere with its membrane integration

  • Vaccine Development Opportunities:
    As a membrane protein, YciC might have exposed epitopes accessible to the immune system:

    • Identification of surface-exposed regions for subunit vaccine development

    • Assessment of conservation across pathogenic E. coli strains to determine breadth of coverage

    • Evaluation as a carrier protein for conjugate vaccines

    • Potential inclusion in outer membrane vesicle (OMV) vaccine formulations

  • Bacterial Physiology Insights with Therapeutic Relevance:
    Understanding YciC's role might reveal new aspects of bacterial membrane biology:

    • Identification of stress response mechanisms that could be targeted

    • Discovery of membrane biogenesis pathways essential for bacterial survival

    • Elucidation of bacterial adaptation mechanisms to host environments

    • Insights into bacterial persistence mechanisms that contribute to treatment failure

  • Biotechnological Applications:
    Knowledge of YciC structure and function could enable biotechnological applications:

    • Development as a scaffold for display of heterologous antigens

    • Utilization in bacterial surface display technologies

    • Potential as a component in biosensors or diagnostic tools

    • Incorporation into synthetic biology circuits for engineered bacteria

While the therapeutic potential depends on the specific function identified for YciC, its position as a membrane protein in a pathogenic bacterium makes it particularly relevant for infection-related therapeutic strategies.

How can researchers integrate computational and experimental approaches for comprehensive characterization of YciC?

A comprehensive characterization of YciC requires seamless integration of computational and experimental approaches in an iterative workflow:

  • Integrative Structural Biology Pipeline:

    • Initial sequence-based predictions guide experimental design

    • Low-resolution experimental data refines computational models

    • Refined models direct site-specific experimental probes

    • High-resolution structural data validates and corrects computational predictions

    This iterative process might begin with topology predictions that inform the design of reporter fusion constructs, followed by experimental validation that refines the computational model.

  • Functional Characterization Integration:

    • Computational prediction of functional sites directs mutagenesis studies

    • Experimental phenotypic data informs systems biology models

    • Network analysis predictions guide protein interaction studies

    • Experimental interaction data refines network models

    For example, computational analysis might identify conserved residues likely to be functionally important, which then become targets for site-directed mutagenesis to experimentally verify their significance.

  • Dynamic Analysis Framework:

    • Molecular dynamics simulations predict protein motions

    • Experimental techniques (HDX-MS, NMR, FRET) validate dynamic predictions

    • Validated simulations explore conditions difficult to achieve experimentally

    • Experimental results under varied conditions benchmark simulation accuracy

    This approach could reveal how YciC responds to changes in membrane composition or environmental stressors through both computational prediction and experimental verification.

  • Multi-scale Modeling with Experimental Anchoring:

    • Quantum mechanical calculations of specific interactions

    • All-atom simulations of protein domains

    • Coarse-grained models of whole-system behavior

    • Experimental measurements at corresponding scales validate each level

    For membrane insertion studies, this might involve quantum calculations of specific lipid-protein interactions, validated by spectroscopic measurements, that inform larger-scale simulations of the complete insertion process.

  • Data Integration Platform Development:

    • Customized databases to organize diverse data types

    • Visualization tools that integrate computational and experimental results

    • Statistical frameworks to evaluate consistency between approaches

    • Machine learning methods to identify patterns across multiple datasets

    Such platforms facilitate the synthesis of information from various sources, enabling researchers to identify consistencies and resolve contradictions between computational predictions and experimental observations.

This integrated approach maximizes the value of both computational and experimental techniques, using each to compensate for the limitations of the other and progressively building a more complete understanding of YciC's structure, dynamics, and function.

What are the most significant knowledge gaps regarding UPF0259 membrane protein YciC?

Despite advances in membrane protein research, several critical knowledge gaps remain concerning UPF0259 membrane protein YciC:

  • Functional Annotation: The most fundamental gap is the lack of a defined biological function for YciC. While classified in the UPF0259 family, its specific cellular role remains uncharacterized. This absence of functional data represents a significant obstacle to understanding its importance in bacterial physiology.

  • High-Resolution Structure: No experimental three-dimensional structure of YciC has been determined to date. This structural gap limits our understanding of its membrane topology, potential binding sites, and mechanistic insights that could be derived from structural analysis.

  • Protein Interaction Network: The protein-protein interaction landscape of YciC remains largely unexplored. Identifying interaction partners would provide valuable clues to its functional context within the bacterial cell.

  • Regulation Mechanisms: The conditions under which yciC expression is regulated, including potential responses to environmental stressors or growth phases, have not been comprehensively characterized.

  • Evolutionary Significance: While sequence data exists across bacterial species, the evolutionary pressures that have shaped YciC and its homologs are poorly understood, limiting insights into its conservation and potential specialized functions.

Addressing these knowledge gaps would not only enhance our understanding of YciC specifically but would also contribute to the broader field of membrane protein biology and bacterial physiology.

What consensus methods should researchers apply when working with poorly characterized membrane proteins like YciC?

When researching poorly characterized membrane proteins like YciC, a consensus methodological approach incorporating multiple complementary techniques yields the most robust results:

  • Sequential Characterization Workflow:

    • Begin with bioinformatic analysis to generate initial hypotheses

    • Proceed to expression and purification optimization

    • Conduct preliminary structural characterization

    • Perform targeted functional assays based on structural insights

    • Validate findings using genetic approaches

    This sequential approach builds each step upon previous findings, gradually constructing a comprehensive understanding.

  • Multi-technique Structural Analysis:

    • Implement at least three independent structural prediction methods

    • Validate computational models with experimental techniques (CD, NMR, EPR)

    • Apply complementary structural determination methods

    • Cross-validate findings between different approaches

    For YciC, this might involve comparing AlphaFold2 predictions with experimental topology mapping and limited proteolysis results to ensure consistency.

  • Integrated Functional Characterization:

    • Combine phenotypic analysis of gene deletions or mutations

    • Employ biochemical assays testing multiple potential functions

    • Perform localization studies under different conditions

    • Analyze protein-protein and protein-lipid interactions

    This multifaceted approach avoids bias toward a single hypothesized function and can reveal unexpected roles.

  • Standardized Reporting Practices:

    • Document all experimental conditions comprehensively

    • Report both positive and negative results

    • Quantify uncertainties and reproducibility

    • Share raw data through appropriate repositories

    These practices facilitate comparison between studies and accelerate collective progress in the field.

  • Collaborative Research Networks:

    • Engage complementary expertise across different laboratories

    • Implement standardized protocols for cross-laboratory validation

    • Share resources such as constructs, antibodies, and cell lines

    • Coordinate research efforts to avoid duplication

    For challenging proteins like YciC, collaborative approaches combining specialized expertise often yield breakthroughs more efficiently than isolated efforts.

This consensus approach maximizes research efficiency and reliability when investigating poorly characterized membrane proteins, providing a roadmap for researchers entering this challenging field.

How might advances in structural biology techniques change our approach to studying proteins like YciC in the next decade?

Emerging advances in structural biology techniques are poised to transform research on membrane proteins like YciC over the coming decade:

  • Revolution in Cryo-EM Capabilities:

    • Continued improvements in resolution for smaller proteins (potentially below 100 kDa)

    • Development of membrane-specific sample preparation techniques

    • Computational methods for dealing with conformational heterogeneity

    • Integration with mass photometry for single-particle analysis

    These advances may soon make it possible to determine YciC structures directly in native-like membrane environments without crystallization.

  • AI-Powered Structural Prediction and Analysis:

    • Further refinement of AlphaFold-like algorithms specifically for membrane proteins

    • Integration of sparse experimental data with prediction algorithms

    • Automated structure-based functional annotation

    • Prediction of dynamic conformational ensembles rather than static structures

    These tools will accelerate hypothesis generation and experimental design for proteins like YciC.

  • Single-Molecule Technologies:

    • Advanced FRET techniques for mapping conformational changes in real-time

    • High-speed atomic force microscopy for visualizing membrane protein dynamics

    • Single-molecule mass spectrometry for analyzing individual protein states

    • Nanopore-based approaches for studying membrane protein insertion

    These methods will reveal functionally relevant dynamics that are currently inaccessible.

  • In-cell Structural Biology:

    • Cryo-electron tomography with improved resolution for in situ visualization

    • In-cell NMR techniques adapted for membrane proteins

    • Genetically encoded probes for tracking protein conformations in living cells

    • Correlative light and electron microscopy with molecular specificity

    Studying YciC directly in its native cellular environment will provide unprecedented contextual insights.

  • Integration Platforms and Computational Frameworks:

    • Automated pipelines integrating multiple data types

    • Virtual reality visualization of integrated structural data

    • Machine learning approaches for identifying patterns across diverse datasets

    • Federated databases for membrane protein structural and functional information

    These integrative approaches will transform how we synthesize information about complex membrane systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.