Recombinant Escherichia coli UPF0266 membrane protein yobD (yobD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli UPF0266 Membrane Protein yobD (yobD)

Recombinant Escherichia coli UPF0266 membrane protein yobD (yobD) is a recombinant protein derived from the bacterium Escherichia coli. This protein belongs to the UPF0266 family, which is characterized by its role in membrane functions within bacteria. The yobD protein is specifically associated with the membrane of E. coli and is involved in various cellular processes, although its exact function remains somewhat unclear due to limited research.

Characteristics of Recombinant Escherichia coli UPF0266 Membrane Protein yobD (yobD)

  • Species: The protein is derived from Escherichia coli, a common bacterium found in the human intestine and widely used in biotechnology.

  • Protein Type: It is a recombinant membrane protein, meaning it is produced through genetic engineering techniques to express the protein in a host organism.

  • Expression Region: The full-length protein typically spans from amino acid 1 to 152, depending on the specific construct used for expression .

  • Function: While specific functions are not well-documented, membrane proteins generally play roles in transport, signaling, and structural support within the bacterial cell membrane.

Research Findings and Applications

Despite the limited specific research on the yobD protein, recombinant membrane proteins like yobD are valuable tools in biotechnology and biomedical research. They can be used to study bacterial membrane functions, develop vaccines, or serve as antigens in diagnostic assays.

ApplicationDescription
BiotechnologyUsed in genetic engineering to study membrane functions and develop new bioproducts.
Vaccine DevelopmentRecombinant proteins can be used as vaccine components to induce immune responses.
Diagnostic ToolsCan serve as antigens in assays to detect antibodies against specific bacterial infections.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If a specific tag is required, please inform us, and we will prioritize its incorporation.
Synonyms
yobD; ECDH10B_1958; UPF0266 membrane protein YobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-152
Protein Length
full length protein
Species
Escherichia coli (strain K12 / DH10B)
Target Names
yobD
Target Protein Sequence
MTITDLVLILFIAALLAFAIYDQFIMPRRNGPTLLAIPLLRRGRIDSVIFVGLIVILIYN NVTNHGALITTWLLSALALMGFYIFWIRVPKIIFKQKGFFFANVWIEYSRIKAMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKLLVSTQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0266 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the optimal expression system for recombinant yobD membrane protein in E. coli?

For membrane proteins like yobD, the selection of an appropriate expression system is critical. While BL21(DE3) strains are commonly used for recombinant protein expression, the C41(DE3) and C43(DE3) strains are particularly recommended for membrane proteins. These Walker strains contain mutations in the lacUV5 promoter region that revert it to a weaker wild-type promoter, resulting in reduced expression levels that are often more tolerable for the cell when expressing membrane proteins .

For yobD specifically, a combination of an appropriate vector (such as pET series with T7 promoter) and these specialized strains would provide a balanced expression system. When designing your expression system, consider using a tightly controlled inducible promoter to minimize basal expression, which can be toxic for membrane proteins prior to induction .

How can I determine if codon bias is affecting yobD protein expression?

Codon bias occurs when the frequency of codons in your protein of interest differs significantly from the host organism. For recombinant yobD expression in E. coli, analyze your gene sequence using specialized codon analysis tools to identify rare codons (defined as those used by E. coli at a frequency <1%) . Pay particular attention to arginine codons like AGG, which is used at a frequency of <0.2% in E. coli .

To address codon bias issues:

  • Perform gene optimization for E. coli usage

  • Use E. coli strains supplemented with tRNAs for rare codons (e.g., Rosetta strains)

  • Analyze the distribution of rare codons - clusters of rare codons are particularly problematic

The presence of sequential rare codons early in the sequence can have more significant effects on expression than isolated rare codons later in the gene.

What targeting strategies work best for yobD membrane protein insertion?

As a membrane protein, yobD can be targeted to the membrane through different pathways. Two principal approaches are:

Post-translational Sec-dependent pathway: This requires fusion of yobD to a signal peptide such as those from Lpp, OmpA, PelB, or PhoA . The protein is fully synthesized before translocation and insertion.

Co-translational SRP pathway: For membrane proteins like yobD, the SRP pathway is often more effective. This system recognizes hydrophobic signal sequences at the N-terminal end of the nascent chain during translation. The DsbA signal sequence has been successfully used to target recombinant proteins to the periplasm via this pathway .

Targeting PathwaySignal PeptidesAdvantagesBest For
Sec-dependent (post-translational)Lpp, LamB, OmpA, PelB, PhoABetter for periplasmic soluble proteinsProteins that can remain unfolded during translocation
SRP-dependent (co-translational)DsbAPrevents premature folding, better for membrane proteinsHydrophobic proteins, membrane proteins like yobD

For yobD, the SRP pathway is typically recommended due to its membrane localization and hydrophobic nature.

How can I overcome inclusion body formation during yobD expression?

Inclusion body (IB) formation is a common challenge when expressing membrane proteins like yobD in E. coli. This occurs when the hydrophobic regions of yobD aggregate due to improper membrane insertion or folding . To overcome this issue:

  • Lower expression temperature: Reduce to 18-25°C to slow protein synthesis and allow proper folding

  • Reduce inducer concentration: Use lower IPTG concentrations (0.1-0.5 mM) to decrease expression rate

  • Fusion partners: Add solubility-enhancing fusion tags such as MBP (maltose-binding protein), SUMO, or Thioredoxin

  • Chaperone co-expression: Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ) to assist folding

  • Membrane-mimetic additives: Include mild detergents or lipids in growth medium

If IBs persist, consider whether they might be advantageous for purification. Some researchers intentionally direct expression to IBs, followed by solubilization and refolding, which can provide a simple one-step purification method .

What role does YidC play in the proper insertion of yobD into the membrane, and how can I study this?

YidC plays a crucial role in membrane protein insertion and folding. For proteins like yobD, YidC can function both independently and in cooperation with the SecYEG translocon . It assists in:

  • Facilitating the exit of transmembrane helices from the lateral gate of the translocon

  • Proper folding of transmembrane domains in the membrane environment

  • Assembly of membrane protein complexes

YidC contains a hydrophilic groove that is exposed to the membrane on one side and forms a critical part of the insertion machinery . Molecular dynamics simulations suggest this groove is filled with water molecules during the idle state .

To study YidC's role in yobD insertion:

Experimental approach:

  • Create YidC depletion strains and monitor yobD insertion efficiency

  • Perform site-directed mutagenesis on key YidC residues in the hydrophilic groove

  • Use in vitro reconstitution systems with purified components (YidC, ribosomes, and yobD)

  • Employ crosslinking studies to map interaction points between YidC and yobD during insertion

How does phospholipid composition affect yobD insertion and stability?

The phospholipid environment significantly impacts membrane protein insertion and stability. For yobD insertion, consider:

Phospholipid effects:

  • Bilayer thickness: The hydrophobic thickness of the membrane must match the hydrophobic region of yobD transmembrane domains to prevent hydrophobic mismatch

  • Lateral pressure profile: Different phospholipids create various lateral pressures that can affect insertion energetics

  • Surface charge: The negatively charged phospholipids PG and cardiolipin (CL) appear to facilitate the binding of insertion machinery components like FtsY to the membrane

Research approach to study phospholipid effects:

  • Reconstitute yobD into liposomes of defined composition

  • Systematically vary PE/PG/CL ratios to determine optimal insertion conditions

  • Use fluorescence-based assays to monitor insertion efficiency and protein stability

  • Perform molecular dynamics simulations to identify lipid-protein interactions

PhospholipidEffect on Insertion MachineryRole in Membrane Protein Stability
Phosphatidylethanolamine (PE)Neutral, forms hydrogen bondsProvides curvature stress, stabilizes protein folding
Phosphatidylglycerol (PG)Negatively charged, attracts FtsYEnhances SecA and FtsY binding to membrane
Cardiolipin (CL)Strongly negative, binds insertion factorsStabilizes membrane protein complexes

What strategies can I use to distinguish between properly inserted and misfolded yobD in the membrane?

Distinguishing between properly inserted and misfolded yobD requires multiple analytical approaches:

Biochemical methods:

  • Protease accessibility assays: Domains properly inserted into or across membranes will show differential protease sensitivity

  • Cysteine scanning mutagenesis: Introduce cysteine residues at various positions and test their accessibility to membrane-impermeable sulfhydryl reagents

  • Disulfide mapping: Analyze formation of disulfide bonds between engineered cysteines to validate predicted topological relationships

Biophysical methods:

  • Circular dichroism (CD): Assess secondary structure content and stability

  • FTIR spectroscopy: Determine secondary structure in membrane environments

  • Differential scanning calorimetry (DSC): Measure thermal stability as an indicator of proper folding

Functional assays:
Develop activity assays specific to yobD's function (if known) to correlate structure with activity

For yobD specifically, remember that disulfide bond formation typically occurs in the periplasm in E. coli, and is rare in the cytoplasm due to its reducing environment . If yobD contains disulfide bonds, consider expressing it with the appropriate targeting to the periplasmic space.

How can I optimize the co-translational insertion of yobD using the SRP pathway?

To optimize co-translational insertion via the SRP pathway:

  • Engineer optimal signal sequences: The hydrophobicity and length of the signal sequence influence SRP recognition. Consider using the DsbA signal sequence which has been successful for other membrane proteins .

  • Manipulate FtsY levels: FtsY is the SRP receptor that facilitates transfer of the ribosome-nascent chain complex to the translocon. It localizes to the membrane through lipid-binding helices that preferentially interact with negatively charged phospholipids like PG and CL .

  • Optimize membrane composition: The SRP receptor FtsY has preference for negatively charged phospholipids . Consider:

    • Using E. coli strains with altered phospholipid composition

    • Adding specific phospholipids to growth media

    • Reconstituting the system in vitro with defined lipid compositions

  • Monitor SecYEG-FtsY interactions: The C4 and C5 loops of SecY interact with FtsY, aiding in the localization of the SRP receptor at the membrane . Mutations in these regions could impact insertion efficiency.

Experimental verification approach:

  • Use ribosome profiling to monitor translation rates

  • Employ fluorescent reporter fusions to visualize insertion in real-time

  • Perform pulse-chase experiments to track the kinetics of membrane insertion

What are the most effective troubleshooting strategies for low yobD expression yields?

When facing low yields of recombinant yobD, implement this systematic troubleshooting approach:

Problem assessment:

  • Determine if the issue is expression, solubility, or stability by analyzing samples at different stages

  • Check for protein toxicity by monitoring growth rates compared to empty vector controls

  • Verify mRNA production through RT-PCR to distinguish transcriptional from translational issues

Strategic interventions:

  • For toxic effects: Use specialized strains like C41(DE3) or C43(DE3) which are designed to withstand toxic membrane protein expression

  • For inclusion body formation:

    • Lower temperature and inducer concentration

    • Use solubility-enhancing fusion partners

    • Consider directed evolution approaches to select for more soluble variants

  • For protein degradation:

    • Add protease inhibitors

    • Use protease-deficient host strains

    • Optimize harvest timing to catch expression before degradation

Expression system optimization matrix:

ParameterTest RangeOptimization Metric
Temperature16°C, 25°C, 30°C, 37°CSoluble protein yield per liter
Inducer concentration0.01-1.0 mM IPTGRatio of soluble to insoluble protein
Media compositionLB, TB, 2xYT, M9Cell density and protein yield
Induction timingEarly, mid, late log phaseFinal yield and solubility
Host strainBL21(DE3), C41(DE3), C43(DE3), Lemo21Growth curves and protein yield

How can I validate the structural integrity of purified recombinant yobD?

Validating the structural integrity of membrane proteins like yobD requires multiple complementary approaches:

Structural validation techniques:

  • Circular dichroism (CD): Compare the secondary structure content with predictions based on the amino acid sequence

  • Size-exclusion chromatography (SEC): Assess oligomeric state and homogeneity

  • Thermal stability assays: Measure the melting temperature using differential scanning fluorimetry (DSF) or CD

  • Limited proteolysis: Correctly folded proteins show distinct proteolytic patterns compared to misfolded variants

Functional validation:
While specific functional assays depend on yobD's activity, general approaches include:

  • Ligand binding assays if binding partners are known

  • Reconstitution into proteoliposomes to test membrane integrity

  • Electrophysiological measurements if yobD functions as a channel or transporter

Structural homogeneity assessment:

  • Negative-stain electron microscopy to visualize protein particles

  • Mass spectrometry to confirm exact mass and identify any modifications

  • Dynamic light scattering to assess polydispersity

Remember that membrane proteins are particularly sensitive to their environment, and detergent selection is critical for maintaining structural integrity during purification and analysis.

How can I resolve contradictory results in topology studies of yobD?

Contradictory results in membrane protein topology studies are common and require systematic resolution:

Sources of contradictions:

  • Method-specific artifacts: Different techniques (e.g., protease accessibility vs. reporter fusions) may yield conflicting results

  • Experimental conditions: Variations in membrane composition, pH, or salt concentration can alter topology

  • Partial insertion: Some transmembrane segments may show dynamic insertion behavior

Resolution strategies:

  • Multi-method validation: Apply at least three independent techniques:

    • Reporter fusion approaches (PhoA, GFP, LacZ)

    • Cysteine accessibility

    • Epitope mapping

    • Protease protection assays

  • Controlled comparisons:

    • Use the same expression system across all methods

    • Ensure consistent membrane conditions

    • Include well-characterized control membrane proteins

  • Computational validation:

    • Compare experimental results with topology prediction algorithms

    • Use molecular dynamics simulations to test stability of alternative topologies

Consensus-building approach:
Create a scoring matrix where each experimental result contributes evidence for or against specific topological models. Weight the evidence based on the reliability of each method and look for convergence toward a consensus model.

Topology FeatureMethod 1 ResultMethod 2 ResultMethod 3 ResultComputational PredictionConsensus
N-terminus locationCytoplasmicCytoplasmicPeriplasmicCytoplasmicCytoplasmic (3/4)
TM1 boundaryResidues 15-35Residues 12-32Residues 14-34Residues 13-33Residues 13-34
Loop 1 locationPeriplasmicPeriplasmicPeriplasmicPeriplasmicPeriplasmic (4/4)

What techniques are most effective for studying yobD interactions with the SecYEG translocon?

Investigating interactions between yobD and the SecYEG translocon requires specialized methods suited for membrane protein complexes:

In vivo techniques:

  • Genetic approaches: Utilize SecY mutants to identify critical interaction regions

  • Crosslinking studies: Use photo-activatable or chemical crosslinkers incorporated at specific positions to capture transient interactions

  • Two-hybrid systems adapted for membrane proteins: Such as TOXCAT or GALLEX assays

In vitro techniques:

  • Site-specific crosslinking in reconstituted systems: Purify components and reconstitute with controlled stoichiometry

  • Surface plasmon resonance (SPR): Measure direct binding kinetics between immobilized SecYEG and detergent-solubilized yobD

  • Fluorescence resonance energy transfer (FRET): Label SecYEG and yobD with fluorophore pairs to detect proximity during insertion

Structural approaches:

  • Cryo-electron microscopy: Capture the insertion intermediate complex

  • X-ray crystallography: Attempt co-crystallization of yobD with the translocon or components

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map interaction surfaces through differential solvent accessibility

The lateral gate of SecYEG, formed between transmembrane helices TM2b and TM7, is particularly important for membrane protein insertion . Focus investigation on this region to determine how yobD transmembrane segments interact with this gate during the insertion process.

How does the absence of disulfide bond formation capability in the E. coli cytoplasm affect yobD structure and function?

The reducing environment of the E. coli cytoplasm typically prevents disulfide bond formation, which can impact membrane proteins that require such bonds for proper folding :

Strategies to address disulfide bond issues:

  • Target to the periplasm: Direct yobD to the periplasmic space where the Dsb family of enzymes can catalyze disulfide exchange reactions

  • Use specialized strains: Consider E. coli strains with altered cytoplasmic redox potential:

    • SHuffle strains express disulfide bond isomerase DsbC in the cytoplasm

    • Origami strains have mutations in both thioredoxin reductase (trxB) and glutathione reductase (gor) genes, creating a more oxidizing cytoplasm

  • In vitro oxidative folding: Express yobD, purify under reducing conditions, then refold in vitro with controlled oxidation

Experimental assessment:

  • Compare yobD expression in regular E. coli strains versus those with oxidizing cytoplasm

  • Analyze the number and positions of cysteine residues in yobD to predict potential disulfide bonds

  • Use mass spectrometry to map which cysteines form disulfide bonds under different conditions

  • Test functional activity correlation with disulfide bond formation

The absence of proper disulfide bonds can lead to protein misfolding, aggregation, or altered function, particularly if these bonds are critical for maintaining proper tertiary structure or function of yobD.

What emerging technologies might improve structural studies of recombinant yobD?

Recent technological advances have expanded our ability to study challenging membrane proteins like yobD:

  • Cryo-electron microscopy (cryo-EM): The "resolution revolution" in cryo-EM now enables structural determination of membrane proteins without crystallization, often in more native-like environments

  • Nanodiscs and SMALPs (styrene maleic acid lipid particles): These technologies allow membrane proteins to be studied in a lipid bilayer environment rather than detergent micelles, potentially preserving native conformations

  • AlphaFold and other AI protein structure prediction tools: These computational approaches can provide structural hypotheses for membrane proteins that have been resistant to experimental structure determination

  • Cell-free expression systems: These bypass cellular toxicity issues and allow direct incorporation into nanodiscs or liposomes during synthesis

  • Integrative structural biology: Combining multiple lower-resolution techniques (SAXS, HDX-MS, crosslinking-MS, EPR) with computational modeling to derive structural information

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.