Recombinant Escherichia coli UPF0283 membrane protein YcjF (ycjF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ycjF; b1322; JW1315; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ycjF
Target Protein Sequence
MTEPLKPRIDFDGPLEVDQNPKFRAQQTFDENQAQNFAPATLDEAQEEEGQVEAVMDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is known about the function of YcjF protein in E. coli?

YcjF is a membrane protein with functions that have not been fully characterized. Research suggests that it may be involved in stress response pathways in E. coli. Gene network analyses have identified YcjF as part of stress-responsive gene clusters that help bacteria survive extreme environmental conditions, potentially contributing to virulence or drug resistance mechanisms . The protein appears to be part of a larger functional network that includes proteins involved in adaptation to environmental stressors, though its precise molecular function remains to be fully elucidated.

How does YcjF relate to other proteins in the UPF0283 family?

YcjF belongs to the UPF0283 family of membrane proteins, which are found across various bacterial species. Structural and sequence analyses suggest that these proteins share conserved domains and potentially similar functions. The YcjF protein appears to be functionally related to YcjN, another protein expressed from the same gene cluster involved in carbohydrate import and metabolism in E. coli . While YcjN has been characterized as a substrate-binding protein with a structure similar to the maltose binding protein (MBP), the specific functional relationship between YcjF and YcjN requires further investigation to determine their coordinated roles in bacterial metabolism.

What are the most effective systems for recombinant expression of YcjF?

For recombinant expression of YcjF, E. coli expression systems have proven most effective, particularly for a bacterial membrane protein like YcjF. The standard methodology involves:

  • Cloning the ycjF gene into an expression vector containing an N-terminal His-tag

  • Transforming the construct into an E. coli expression strain (BL21(DE3) or similar)

  • Inducing protein expression with IPTG at optimal concentrations (typically 0.1-1.0 mM)

  • Growing cultures at lower temperatures (16-25°C) after induction to enhance proper folding

This approach has successfully yielded recombinant full-length YcjF protein (1-353 amino acids) fused to an N-terminal His tag . For membrane proteins like YcjF, specialized E. coli strains engineered for membrane protein expression may provide higher yields and better folding.

What purification strategies yield the highest purity of functional YcjF protein?

Purification of YcjF protein to greater than 90% purity can be achieved through a multi-step process:

  • Cell lysis and membrane fraction isolation: Using mechanical disruption (sonication or high-pressure homogenization) followed by differential centrifugation to isolate membrane fractions

  • Membrane protein solubilization: Using appropriate detergents (e.g., DDM, LDAO, or Triton X-100) to solubilize the membrane protein

  • Affinity chromatography: Utilizing Ni-NTA chromatography to capture the His-tagged YcjF protein

  • Size exclusion chromatography: As a polishing step to remove aggregates and obtain homogeneous protein

The choice of detergent is critical for maintaining YcjF in a properly folded, functional state. The final purified product is typically stored in a buffer containing 6% trehalose at pH 8.0 to maintain stability . For functional studies, reconstitution into lipid bilayers or nanodiscs may be necessary to preserve native conformation and activity.

How can researchers assess the proper folding and functionality of purified YcjF?

To assess proper folding and functionality of purified YcjF, researchers should employ multiple complementary techniques:

  • Circular Dichroism (CD) Spectroscopy: To analyze the secondary structure content and confirm proper folding of the protein

  • Thermal Shift Assays: To assess protein stability and the effect of different buffer conditions

  • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS): To determine the oligomeric state and homogeneity of the protein preparation

  • Proteoliposome Reconstitution: To assess membrane integration and potential functional assays

  • Binding Assays: If ligands are identified, binding studies using isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR)

For membrane proteins like YcjF, proper folding often correlates with monodispersity in detergent solutions, which can be assessed through dynamic light scattering measurements similar to those used for YcjN . Additionally, comparison with non-recombinant YcjF through immunological methods may provide insights into structural integrity.

What techniques have been most successful for determining the three-dimensional structure of YcjF?

While the three-dimensional structure of YcjF has not yet been fully determined, based on successful structural studies of related proteins like YcjN , the following techniques would likely be most effective:

  • X-ray Crystallography: This would require:

    • High-purity, homogeneous protein preparations

    • Screening of hundreds of crystallization conditions

    • Optimization of crystal growth for diffraction quality

    • Use of specialized crystallization approaches for membrane proteins (e.g., lipidic cubic phase)

  • Cryo-Electron Microscopy (cryo-EM): Particularly useful if YcjF forms complexes or if crystallization proves challenging

    • Sample preparation in appropriate detergents or nanodiscs

    • Screening for optimal vitrification conditions

    • High-resolution data collection on modern cryo-EM instruments

  • Nuclear Magnetic Resonance (NMR): For specific domains or if the full protein is amenable to solution NMR

    • Isotopic labeling (15N, 13C, 2H) during expression

    • Optimization of solution conditions for spectral quality

The approach used for YcjN, which determined its crystal structure to a resolution of 1.95 Å, provides a potential template for structural studies of YcjF . Additionally, computational approaches leveraging homology modeling may provide preliminary structural insights.

How does post-translational modification affect the structure and function of YcjF?

Post-translational modifications of YcjF have not been extensively characterized, but insights can be drawn from related proteins. For example, YcjN has been found to form a lipidated form that is posttranslationally diacylated at cysteine 21 . Similar modifications might occur in YcjF and could significantly affect:

  • Membrane Localization: Lipidation could anchor the protein more firmly in the membrane

  • Protein-Protein Interactions: Modified residues might create or disrupt interfaces for interaction with other proteins

  • Conformational Stability: PTMs could stabilize certain conformational states

  • Enzymatic Activity: If YcjF possesses enzymatic activity, modifications could regulate it

Research methodologies to investigate these effects would include:

  • Comparative mass spectrometry to identify modification sites

  • Size-exclusion chromatography to assess changes in oligomeric state

  • Dynamic light scattering to detect structural changes

  • Functional assays comparing modified and unmodified forms

Researchers should carefully consider expression systems when studying YcjF, as some might not reproduce the native modification pattern observed in E. coli .

What experimental approaches are most effective for determining the physiological role of YcjF in E. coli?

To determine the physiological role of YcjF in E. coli, a multi-faceted experimental approach is recommended:

  • Gene Knockout/Knockdown Studies:

    • Generate ycjF deletion mutants using CRISPR-Cas9 or traditional homologous recombination

    • Assess phenotypic changes across multiple growth conditions

    • Perform complementation studies to confirm specificity

  • Transcriptomic and Proteomic Analyses:

    • Compare gene expression profiles between wild-type and ycjF mutants using RNA-Seq

    • Use quantitative proteomics to identify changes in protein abundance

    • Analyze data under normal and stress conditions to identify condition-specific roles

  • Protein-Protein Interaction Studies:

    • Perform pull-down assays with tagged YcjF to identify interaction partners

    • Use bacterial two-hybrid systems to confirm specific interactions

    • Conduct crosslinking studies to capture transient interactions

  • Metabolic Profiling:

    • Compare metabolite profiles between wild-type and ycjF mutants

    • Focus on pathways implicated by transcriptomic/proteomic data

Based on current knowledge, investigating YcjF's role in stress response pathways would be particularly valuable, as gene network analyses have associated it with stress response mechanisms in E. coli .

How does YcjF contribute to bacterial stress response mechanisms?

Research suggests YcjF is involved in bacterial stress response mechanisms through several possible pathways:

  • Oxidative Stress Response: Gene network analyses have identified YcjF among genes differentially expressed under oxidative stress conditions , suggesting potential roles in:

    • Protection against reactive oxygen species

    • Maintenance of redox homeostasis

    • Cell membrane integrity during oxidative damage

  • Antibiotic Stress Response: YcjF expression changes have been observed during antibiotic treatment , potentially contributing to:

    • Membrane permeability alterations

    • Efflux pump regulation or function

    • Cell wall stress response pathways

  • Temperature Stress Adaptation: Expression patterns indicate potential involvement in both heat and cold stress responses , possibly through:

    • Membrane fluidity regulation

    • Protein stabilization mechanisms

    • Metabolic adaptations to temperature changes

The precise molecular mechanisms remain to be elucidated, but YcjF likely functions within larger protein networks that collectively enable bacterial adaptation to environmental stressors. Its membrane localization suggests it may play a role in maintaining membrane integrity or function during stress conditions.

What is the relationship between YcjF and other proteins in the ycj gene cluster?

The ycj gene cluster in E. coli contains several genes including ycjF and ycjN, which appear to function in related pathways:

  • Functional Relationship with YcjN:

    • YcjN has been characterized as a substrate-binding protein involved in carbohydrate import and metabolism

    • Its structure resembles substrate binding proteins in subcluster D-I, which includes the maltose binding protein (MBP)

    • This suggests YcjF may be involved in carbohydrate transport or metabolism, potentially forming part of a transport system with YcjN

  • Gene Cluster Organization:

    • Genes in prokaryotic operons often encode proteins of related function

    • The ycj cluster likely represents a functional unit for a specific metabolic or transport process

    • Co-regulation of these genes under specific conditions supports their functional relationship

  • Protein-Protein Interactions:

    • YcjF may physically interact with YcjN or other proteins encoded by the ycj cluster

    • These interactions could form functional complexes such as transport systems or metabolic pathways

    • Analysis of protein-protein interaction networks has identified YcjF within clusters of functionally related proteins

Research approaches to further characterize these relationships include co-immunoprecipitation studies, bacterial two-hybrid screens, and phenotypic analysis of combinatorial gene deletions within the ycj cluster.

How can researchers utilize recombinant YcjF in structural genomics and drug discovery pipelines?

Recombinant YcjF can be incorporated into structural genomics and drug discovery pipelines through several strategic approaches:

  • Structural Genomics Applications:

    • Determination of YcjF's three-dimensional structure would fill knowledge gaps in the UPF0283 protein family

    • Comparative structural analysis with homologs from pathogenic bacteria could reveal conserved functional domains

    • Structure-guided functional annotation would provide insights into this uncharacterized protein family

  • Drug Discovery Applications:

    • If YcjF proves essential for bacterial stress response or virulence, it could represent a novel antibacterial target

    • High-throughput screening assays using purified YcjF to identify small molecule binders

    • Fragment-based drug discovery approaches using NMR or X-ray crystallography

    • Structure-based virtual screening once the protein structure is available

  • Methodological Approach for Drug Screening:

    • Express and purify recombinant YcjF to >95% purity

    • Develop stability and activity assays (if functional characterization is available)

    • Conduct primary screens with diverse compound libraries

    • Validate hits through orthogonal binding assays (SPR, ITC, thermal shift)

    • Perform structure-activity relationship studies on promising compounds

The use of recombinant YcjF in drug discovery would be particularly valuable if further research establishes its role in stress response pathways related to antibiotic resistance or virulence .

What are the technical challenges in studying membrane-associated protein complexes involving YcjF?

Studying membrane-associated protein complexes involving YcjF presents several technical challenges that researchers must address:

  • Extraction and Stability Challenges:

    • Maintaining native membrane protein complexes during solubilization

    • Selecting detergents that preserve protein-protein interactions

    • Preventing aggregation or dissociation during purification

  • Structural Analysis Difficulties:

    • Obtaining diffracting crystals of membrane protein complexes

    • Size limitations for solution NMR studies

    • Sample heterogeneity challenges for cryo-EM

  • Functional Reconstitution Issues:

    • Recreating native lipid environments for functional studies

    • Ensuring proper orientation in artificial membranes

    • Developing robust activity assays for complex functions

  • Methodological Solutions:

    • Use of advanced membrane mimetics (nanodiscs, SMALPs, amphipols)

    • Crosslinking approaches to stabilize transient interactions

    • Advanced imaging techniques like FRET to study interactions in membranes

    • Native mass spectrometry for intact complex analysis

These challenges are common to many membrane protein studies, as evidenced by the comparatively slower progress in structural determination of membrane proteins versus soluble proteins . Successful strategies often combine multiple complementary approaches to overcome these technical limitations.

How does bacterial strain variation affect the structure and function of YcjF?

Bacterial strain variation can significantly impact YcjF structure and function through several mechanisms:

  • Sequence Variations:

    • Single nucleotide polymorphisms (SNPs) may alter amino acid composition

    • Insertions or deletions could modify functional domains

    • Promoter region variations may affect expression levels

  • Expression Patterns:

    • Regulatory network differences between strains may alter ycjF expression

    • Stress response pathways may be differentially regulated across strains

    • Growth condition-dependent expression may vary

  • Functional Consequences:

    • Variations may alter substrate specificity if YcjF is involved in transport

    • Stress response capabilities may differ between strains

    • Protein-protein interaction networks may be remodeled

  • Research Implications:

    • Studies should include sequence analysis across multiple E. coli strains

    • Functional characterization should be performed in multiple genetic backgrounds

    • Phenotypic differences between strains may provide clues to YcjF function

This variation is particularly relevant when considering pathogenic versus non-pathogenic E. coli strains, as YcjF's potential role in stress response could contribute to pathogenicity or antibiotic resistance mechanisms . Comparative genomics and functional studies across strain collections would provide valuable insights into these variations.

What are common pitfalls in recombinant expression of YcjF and how can they be overcome?

Researchers commonly encounter several challenges when expressing recombinant YcjF protein:

ChallengeCauseSolution
Poor expression yieldsToxicity of membrane protein overexpressionUse tightly regulated expression systems; lower induction temperature (16-20°C); use specialized E. coli strains (C41/C43)
Protein aggregationImproper folding of hydrophobic domainsCo-express with chaperones (GroEL/GroES); add mild detergents during lysis; optimize buffer conditions
Degradation during expressionProteolytic susceptibilityUse protease-deficient strains; add protease inhibitors; reduce induction time
Low solubilityHydrophobic nature of membrane proteinScreen various detergents (DDM, LDAO, Triton X-100); optimize detergent concentration; consider fusion partners (MBP, SUMO)
Difficulty in purificationNonspecific binding to chromatography mediaOptimize imidazole concentrations; include detergents in purification buffers; consider tandem purification strategies

Additionally, storage stability can be improved by adding 6% trehalose to the storage buffer and avoiding repeated freeze-thaw cycles . Aliquoting the purified protein and storing at -80°C can help maintain long-term stability for functional studies.

How can researchers differentiate between functional and non-functional forms of purified YcjF?

Differentiating between functional and non-functional forms of purified YcjF requires a multi-faceted approach:

  • Biophysical Characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Intrinsic tryptophan fluorescence to monitor tertiary structure

    • Size exclusion chromatography to assess monodispersity versus aggregation

    • Dynamic light scattering to detect proper folding versus misfolded states

  • Functional Assays (dependent on functional characterization):

    • If transport function is established: reconstitution into proteoliposomes for transport assays

    • If enzymatic activity is identified: specific activity measurements

    • Ligand binding studies if binding partners are known

  • Comparative Analysis:

    • Comparison with native YcjF isolated from E. coli membranes

    • Analysis of post-translational modifications present in native versus recombinant forms

    • Assessment of oligomeric state in comparison to native protein

  • Correlation with Structural Integrity:

    • Thermal shift assays to determine stability

    • Proteolytic susceptibility patterns

    • Antibody recognition of conformational epitopes

Without established functional assays, researchers often rely on indirect measures such as proper membrane integration, correct oligomeric state, and structural stability as proxies for functional integrity .

What strategies help resolve contradictory experimental data when studying YcjF function?

When faced with contradictory experimental data regarding YcjF function, researchers should employ these systematic strategies:

  • Methodological Validation and Standardization:

    • Verify reagent quality and specificity (antibodies, recombinant proteins)

    • Standardize experimental conditions across studies

    • Implement appropriate controls for each assay

    • Use multiple detection methods to confirm results

  • Genetic Approach Verification:

    • Confirm genotypes of knockout/knockdown strains

    • Perform complementation studies to verify phenotype specificity

    • Use inducible systems to control expression levels

    • Consider polar effects on neighboring genes

  • Contextual Analysis:

    • Examine strain-specific effects

    • Consider growth and induction conditions

    • Evaluate environmental factors that might influence results

    • Assess protein expression levels across experiments

  • Collaborative Resolution Strategy:

    • Conduct blind replications in independent laboratories

    • Share biological materials to eliminate source variation

    • Develop consensus protocols through collaborative efforts

    • Perform meta-analysis of available data

  • Integration of Multiple Data Types:

    • Combine in vitro biochemical data with in vivo functional studies

    • Correlate structural information with functional outcomes

    • Integrate omics data (transcriptomics, proteomics, metabolomics)

    • Develop mathematical models to reconcile divergent observations

These approaches help distinguish between true biological complexity and experimental artifacts when studying poorly characterized proteins like YcjF .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.