Recombinant Escherichia coli UPF0410 protein ymge (ymgE)

Shipped with Ice Packs
In Stock

Description

Primary Attributes

ParameterDetails
Gene Nameymge
UniProt IDsP76011 (K12 strain), P58767 (O127:H6 strain)
Protein LengthFull-length (1–84 amino acids)
Molecular Weight~8,775 Da
TagN-terminal 10xHis-tag (for affinity chromatography)
Amino Acid SequenceMGIIAWIIFDLIAGIIAKLIMPGRDGGGFFLTCILGIVGAVVGGWLATMFGIGGSISGFN LHSFLVAVVGAILVLGIFRLLRRE

Key Observations:

  • Strain Variations: The O127:H6 strain variant (P58767) exhibits slight sequence divergence (e.g., "FGL" at position 4 vs. "FDL" in K12) .

  • Membrane Localization: Predicted as a transmembrane protein, aligning with its association with stress response pathways .

Expression Systems

SystemDetails
Host OrganismE. coli (common), cell-free expression (niche applications)
Expression RegionFull-length (1–84aa)
PurificationHis-tag affinity chromatography

Notes:

  • Cell-Free Expression: Used for scalable production, though less common than E. coli systems .

  • Purity: ≥85–90% (SDS-PAGE validated) .

Functional and Analytical Uses

ApplicationDescription
SDS-PAGEQuality control and molecular weight confirmation
ELISAAntibody binding assays (e.g., epitope mapping)
Structural StudiesX-ray crystallography or NMR for membrane protein interactions
Transglycosylase ResearchInvestigating its role in cell wall synthesis or stress adaptation

Research Context:

  • The protein is annotated as a "Transglycosylase-associated gene protein," suggesting a role in peptidoglycan remodeling or cross-linking .

  • Limited functional data exists; most applications focus on biochemical characterization .

Recommendations

ParameterGuidelines
Short-Term Storage-20°C/-80°C (lyophilized) or 4°C (working aliquots, ≤1 week)
ReconstitutionDeionized water (0.1–1.0 mg/mL) + 5–50% glycerol (for long-term stability)
Freeze-Thaw CyclesAvoid repeated cycles to prevent aggregation or degradation

Buffer Details:

  • Lyophilized: Tris/PBS-based buffer, 6% trehalose, pH 8.0 .

  • Liquid: Tris-based buffer, 50% glycerol .

Supplier Comparison

SupplierProduct CodePurityPrice (USD/€)Format
Creative BiomartRFL13455EF>90%Inquiry-basedLyophilized powder
CusabioCSB-CF301173ENVNot statedNot listedLyophilized
MyBioSourceMBS7035194≥85%$1,345Liquid (glycerol)
CBM15CSB-CF301173ENVNot stated€1,424Lyophilized

Key Suppliers:

  • Creative Biomart: Offers strain-specific variants (K12 and O127:H6) .

  • MyBioSource: Provides partial-length proteins for niche studies .

  • Cusabio: Focuses on N-terminal His-tagged constructs .

Critical Considerations

  • Stability: Deteriorates rapidly at room temperature; strict cold-chain protocols required .

  • Research Use Only: Not approved for human consumption or therapeutic applications .

  • Sequence Variability: Strain-specific differences (e.g., P76011 vs. P58767) necessitate careful selection for experiments .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a reference for your convenience.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag type if feasible.
Synonyms
ymgE; tag; b1195; JW1184; UPF0410 protein YmgE; Transglycosylase-associated gene protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-84
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ymgE
Target Protein Sequence
MGIIAWIIFDLIAGIIAKLIMPGRDGGGFFLTCILGIVGAVVGGWLATMFGIGGSISGFN LHSFLVAVVGAILVLGIFRLLRRE
Uniprot No.

Target Background

Database Links
Protein Families
UPF0410 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.