Recombinant Escherichia coli UPF0410 protein ymge (ymgE)
Shipped with Ice Packs 
In Stock 
Description
Primary Attributes
Key Observations:
-
Strain Variations: The O127:H6 strain variant (P58767) exhibits slight sequence divergence (e.g., "FGL" at position 4 vs. "FDL" in K12) .
-
Membrane Localization: Predicted as a transmembrane protein, aligning with its association with stress response pathways .
Expression Systems
| System | Details |
|---|---|
| Host Organism | E. coli (common), cell-free expression (niche applications) |
| Expression Region | Full-length (1–84aa) |
| Purification | His-tag affinity chromatography |
Notes:
Functional and Analytical Uses
| Application | Description |
|---|---|
| SDS-PAGE | Quality control and molecular weight confirmation |
| ELISA | Antibody binding assays (e.g., epitope mapping) |
| Structural Studies | X-ray crystallography or NMR for membrane protein interactions |
| Transglycosylase Research | Investigating its role in cell wall synthesis or stress adaptation |
Research Context:
-
The protein is annotated as a "Transglycosylase-associated gene protein," suggesting a role in peptidoglycan remodeling or cross-linking .
-
Limited functional data exists; most applications focus on biochemical characterization .
Recommendations
| Parameter | Guidelines |
|---|---|
| Short-Term Storage | -20°C/-80°C (lyophilized) or 4°C (working aliquots, ≤1 week) |
| Reconstitution | Deionized water (0.1–1.0 mg/mL) + 5–50% glycerol (for long-term stability) |
| Freeze-Thaw Cycles | Avoid repeated cycles to prevent aggregation or degradation |
Buffer Details:
Supplier Comparison
| Supplier | Product Code | Purity | Price (USD/€) | Format |
|---|---|---|---|---|
| Creative Biomart | RFL13455EF | >90% | Inquiry-based | Lyophilized powder |
| Cusabio | CSB-CF301173ENV | Not stated | Not listed | Lyophilized |
| MyBioSource | MBS7035194 | ≥85% | $1,345 | Liquid (glycerol) |
| CBM15 | CSB-CF301173ENV | Not stated | €1,424 | Lyophilized |
Key Suppliers:
-
Creative Biomart: Offers strain-specific variants (K12 and O127:H6) .
-
MyBioSource: Provides partial-length proteins for niche studies .
Critical Considerations
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a reference for your convenience.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag type if feasible.
Synonyms
ymgE; tag; b1195; JW1184; UPF0410 protein YmgE; Transglycosylase-associated gene protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-84
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ymgE
Target Protein Sequence
MGIIAWIIFDLIAGIIAKLIMPGRDGGGFFLTCILGIVGAVVGGWLATMFGIGGSISGFN
LHSFLVAVVGAILVLGIFRLLRRE
Uniprot No.
Target Background
Database Links
KEGG: ecj:JW1184
STRING: 316385.ECDH10B_1248
Protein Families
UPF0410 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
