Recombinant Escherichia coli UPF0603 protein ygcG (ygcG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: We will prioritize shipping the format currently in stock. If you have a specific format requirement, please specify this during order placement.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request and incurs an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ygcG; b2778; JW5445; UPF0603 protein YgcG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-290
Protein Length
Full Length of Mature Protein
Species
Escherichia coli (strain K12)
Target Names
ygcG
Target Protein Sequence
AQPTIVPQLQQQVTDLTSSLNSQEKKELTHKLESIFNNTQVQIAVLIVPTTKDETIEQYA TRVFDNWRLGDAKRNDGILIVVAWSDRTVRIQVGYGLEEKVTDALAGDIIRSNMIPAFKQ QKLAKGLELAINALNNQLTSQHQYPTNPSESESASSSDHYYFAIFWVFAVMFFPFWFFHQ GSNFCRACKSGVCISAIYLLDLFLFSDKIFSIAVFSFFFTFTIFMVFTCLCVLQKRASGR SYHSDNSGSAGGSDSGGFSGGGGSSGGGGASGRW
Uniprot No.

Target Background

Database Links

KEGG: ecj:JW5445

STRING: 316407.85675597

Protein Families
UPF0603 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What expression systems are available for producing recombinant ygcG?

    Recombinant ygcG can be produced using multiple expression systems:

    Expression SystemAdvantagesApplications
    E. coliRapid growth, high yields, simple geneticsBasic research, protein characterization
    YeastPost-translational modifications, secretionHigher structural complexity requirements
    BaculovirusAdvanced eukaryotic PTMs, high expressionComplex folding requirements
    Mammalian CellFull range of PTMs, authentic foldingFunctional studies requiring native structure

    The choice depends on research needs, with E. coli being the most commonly used for basic research due to its simplicity and cost-effectiveness .

  • What basic methods are used for cloning and expressing ygcG in E. coli?

    The standard procedure for cloning and expressing ygcG in E. coli typically involves:

    1. PCR amplification of the ygcG gene from E. coli K12 genomic DNA using specific primers that incorporate restriction sites .

    2. Digestion of both the PCR product and expression vector with appropriate restriction enzymes.

    3. Ligation of the gene into an expression vector containing a suitable promoter (T7, lac, or rhamnose-inducible systems are common) .

    4. Transformation into an E. coli expression strain (BL21(DE3), BL21(DE3)pLysS, or specialized strains) .

    5. Selection of transformants on antibiotic-containing media.

    6. Expression induction using IPTG (for T7/lac promoters) or rhamnose (for rhamnose-inducible promoters) .

    7. Cell harvesting and protein purification, typically using affinity chromatography with a His6-tag .

    For optimal expression, using vectors like pET15b for cytoplasmic expression or vectors containing appropriate signal peptides for periplasmic targeting is recommended .

  • What purification approaches are recommended for recombinant ygcG?

    Purification of recombinant ygcG typically follows this methodological approach:

    1. Affinity tag selection: His6-tag is commonly used and can be added to either the N- or C-terminus of the protein .

    2. Cell lysis: Sonication or chemical lysis using appropriate buffers (typically Tris-based with 50% glycerol) .

    3. Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin.

    4. Intermediate purification: Ion exchange chromatography based on the protein's theoretical pI.

    5. Polishing step: Size exclusion chromatography to obtain high purity.

    6. Buffer optimization: Final buffer should be optimized for protein stability (typically Tris-based buffer with 50% glycerol) .

    If ygcG contains membrane-associated regions, addition of mild detergents during purification may improve solubility and yield .

Advanced Research Questions

  • What signal peptides are most effective for periplasmic expression of ygcG?

    For periplasmic expression of potentially membrane-associated proteins like ygcG, signal peptide selection is critical. Based on research with similar proteins , the following signal peptides have shown varying effectiveness:

    Signal PeptideOriginTargeting PathwayAdvantages for ygcG-like Proteins
    DsbAE. coliSRP-dependentEffective for proteins with hydrophobic regions
    OmpAE. coliSec-dependentGood for moderate-sized soluble domains
    PhoAE. coliSec-dependentContains mature domain targeting signals
    HbpE. coliAutotransporterUseful for complex multi-domain proteins

    A combinatorial screening approach testing these signal peptides with varying production rates (using a titratable rhamnose promoter) is recommended to determine the optimal conditions for ygcG expression . For membrane-associated proteins like ygcG, the DsbA signal peptide may be particularly effective due to its SRP-dependent pathway, which is better suited for proteins with hydrophobic regions .

  • How does the expression of ygcG differ across various E. coli strains?

    Expression of potentially membrane-associated or challenging proteins like ygcG can vary significantly across E. coli strains:

    E. coli StrainFeaturesSuitability for ygcG Expression
    BL21(DE3)Standard expression strain, lacks proteasesGood baseline strain for initial expression tests
    C41(DE3)/C43(DE3)Walker strains with mutations in lacUV5 promoter, better for toxic/membrane proteinsHighly recommended for ygcG due to its potential membrane association
    Lemo21(DE3)Tunable expression system for membrane proteinsExcellent for optimizing expression levels of ygcG
    SHuffleEngineered for disulfide bond formation in cytoplasmBeneficial if ygcG contains disulfide bonds
    W3110 ΔrhaΔlacAllows rhamnose-titratable expressionGood for fine-tuning expression levels

    For membrane-associated proteins like ygcG, C41(DE3)/C43(DE3) or Lemo21(DE3) strains often provide superior results as they were specifically developed for expression of toxic or membrane proteins . A systematic comparison of expression levels across these strains is recommended to determine optimal conditions for ygcG .

  • What are the optimal induction conditions for ygcG expression?

    Optimal induction conditions for ygcG expression should be determined experimentally, but research on similar proteins suggests:

    1. Induction temperature: Lower temperatures (16-25°C) often improve folding and solubility of membrane-associated proteins like ygcG .

    2. Inducer concentration: For IPTG-inducible systems, concentrations between 0.1-0.5 mM are typical. For rhamnose-inducible systems, a concentration series (0.1-10 mM) should be tested to identify optimal expression levels .

    3. Growth phase: Induction at mid-log phase (OD600 = 0.6-0.8) generally provides a balance between biomass and expression capacity.

    4. Duration: Extended expression periods (16-24 hours) at lower temperatures may yield better results for complex proteins.

    5. Media composition: Rich media (LB, TB) for higher biomass or minimal media for better control of expression parameters.

    Experimental design should include an initial screening of these variables, followed by optimization of the most promising conditions. A rhamnose-titratable system may be particularly effective for fine-tuning expression levels of potentially challenging proteins like ygcG .

  • How can genome modification techniques be applied to enhance ygcG expression?

    Several genomic modification approaches can enhance expression of challenging proteins like ygcG:

    1. λ Red Recombineering: This system (utilizing exo, bet, and gam genes) allows precise chromosomal modifications with short homology regions . For ygcG, this could enable:

      • Integration of additional copies of the gene under controlled promoters

      • Modification of native regulatory elements to enhance expression

      • Creation of fusion proteins with solubility-enhancing partners

    2. CRISPR-Cas9 Genome Editing:

      • Precise knock-in/knock-out modifications

      • Multiplexed modifications to enhance expression pathways

      • Engineering of regulatory sequences

    3. Modification of Host Cell Pathways:

      • Deletion of genes encoding proteases that might degrade ygcG

      • Enhancement of chaperone expression to improve folding

      • Modification of secretion machinery for periplasmic expression

    4. Codon Optimization:

      • Adjustment of rare codons to match E. coli's codon usage bias

      • Removal of regulatory sequences that might impede expression

    These techniques can be implemented using established protocols for λ Red recombineering or CRISPR-Cas9 systems in E. coli .

  • What are the challenges in expressing potentially membrane-associated proteins like ygcG?

    Expression of membrane-associated proteins like ygcG presents several challenges:

    1. Toxicity: Overexpression of membrane proteins can saturate the membrane protein biogenesis pathway, leading to toxicity . Solutions include:

      • Using specialized strains like C41(DE3)/C43(DE3) with mutations in the lacUV5 promoter

      • Using tunable expression systems like Lemo21(DE3)

      • Employing tightly regulated promoters (rhamnose-inducible)

    2. Protein folding and aggregation: Hydrophobic regions tend to aggregate in the cytoplasm. Strategies to address this include:

      • Lower expression temperatures (16-25°C)

      • Co-expression with molecular chaperones

      • Fusion to solubility-enhancing tags (MBP, SUMO)

    3. Membrane targeting: Proper insertion into membranes requires:

      • Appropriate signal peptides for SRP-dependent targeting

      • Balanced expression rates to prevent secretion pathway saturation

      • Optimization of leader sequences

    4. Purification challenges: Membrane proteins require:

      • Appropriate detergents for solubilization

      • Modified chromatography conditions

      • Careful buffer optimization to maintain stability

    A systematic approach testing multiple strains, expression conditions, and purification methods is typically required for successful expression of membrane-associated proteins .

  • How can structural and functional studies of ygcG be approached?

    For a poorly characterized protein like ygcG, a comprehensive approach to structural and functional studies would include:

    1. Bioinformatic Analysis:

      • Sequence alignment with homologous proteins

      • Secondary structure prediction

      • Transmembrane domain prediction

      • Identification of conserved motifs

    2. Structural Studies:

      • X-ray crystallography (may require removal of transmembrane regions)

      • Cryo-EM for intact membrane protein structure

      • NMR for soluble domains

      • Circular dichroism for secondary structure analysis

    3. Functional Characterization:

      • Gene knockout studies to identify phenotypic changes

      • Pull-down assays to identify interaction partners

      • Expression pattern analysis under different growth conditions

      • Localization studies using GFP fusions

    4. Enzymatic Activity Testing:

      • Based on structural predictions and homology

      • Systematic screening of potential substrates

      • Activity assays under varying conditions

    For membrane-associated proteins like ygcG, expression optimization is critical before structural and functional studies can be successfully undertaken. A combination of computational predictions and experimental validation is the most efficient approach for characterizing this uncharacterized protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.