Recombinant Escherichia coli UPF0702 transmembrane protein ycaP (ycaP)

What is UPF0702 transmembrane protein YcaP?

YcaP (also known as b0906, JW0889) is a putative inner membrane protein belonging to the UPF0702 family in Escherichia coli . It is a full-length protein consisting of 230 amino acids that functions as a transmembrane protein . The protein is encoded by the ycaP gene and has been classified as part of the UPF0702 family of predicted inner membrane proteins . The amino acid sequence of YcaP is: MKAFDLHRMAFDKVPFDFLGEVALRSLYTFVLVFLFLKMTGRRGVRQMSLFEVLIILTLGSAAGDVAFYDDVPMVPVLIVFITLALLYRLVMWLMAHSEKLEDLLEGKPVVIIEDGELAW SKLNNSNMTEFEFFMELRLRGVEQLGQVRLAILETNGQISVYFFEDDKVKPGLLILPSDCTQRYKVVPESADYACIRCSEIIHMKAGEKQLCPRCANPEWTKASRAKRVT . Its predicted transmembrane domains suggest it plays a role in membrane-associated processes, though its precise biological function remains under investigation.

What expression systems are commonly used for recombinant YcaP production?

Several expression systems have been developed for producing recombinant YcaP protein, with E. coli remaining the predominant host organism due to its genetic tractability and rapid growth characteristics . The most common expression platforms include:

• E. coli-based expression: The protein can be expressed in various E. coli strains such as BL21(DE3), which contains the T7 RNA polymerase system for controlled expression . This system typically involves transformation with pET-based expression vectors containing the ycaP gene fused to an affinity tag.

• Cell-free expression systems: These offer advantages for membrane proteins by eliminating cellular viability constraints and allowing direct integration into artificial membrane environments .

• Alternative hosts: While less common for YcaP specifically, yeast, baculovirus, and mammalian cell expression systems are available options that may provide advantages for proper folding of complex transmembrane proteins .

The choice of expression system depends on research objectives, required protein yields, and the need for post-translational modifications. For detailed structural studies, E. coli remains preferred due to cost-effectiveness and established protocols for membrane protein isolation.

How can recombinant YcaP be purified effectively?

Purification of recombinant YcaP requires specialized protocols due to its transmembrane nature. The most effective methodology includes:

• Affinity tag selection: N-terminal His-tagging is commonly employed for YcaP purification, allowing for single-step affinity chromatography using nickel or cobalt resins . This approach facilitates easier detection and isolation from the complex cellular milieu.

• Membrane solubilization: Prior to chromatography, cell membranes containing YcaP must be solubilized using detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) that maintain protein structure while extracting it from the lipid bilayer.

• Chromatographic techniques: Following initial affinity purification, size exclusion chromatography (SEC) is often employed as a polishing step to separate properly folded YcaP from aggregates or improperly folded species.

• Purity assessment: SDS-PAGE analysis is the standard method for evaluating purification success, with acceptable purity typically exceeding 85-90% . Western blotting using anti-His antibodies or specific anti-YcaP antibodies can confirm identity.

For highest quality preparations, researchers should optimize detergent concentration, buffer composition (particularly pH and salt concentration), and consider the addition of stabilizing agents like glycerol to maintain protein stability throughout the purification process.

What are the recommended storage conditions for purified YcaP protein?

Optimal storage of purified YcaP protein requires careful consideration of buffer composition and temperature to maintain structural integrity and function. Based on established protocols:

• Temperature: Store at -20°C to -80°C for long-term preservation, with -80°C preferred for extended storage periods . Working aliquots may be maintained at 4°C for up to one week to avoid freeze-thaw damage.

• Buffer composition: Tris/PBS-based buffers at pH 8.0 containing 6% trehalose have shown efficacy in maintaining YcaP stability . The addition of trehalose serves as a cryoprotectant that helps preserve protein structure during freezing.

• Glycerol addition: Addition of glycerol to a final concentration of 5-50% is recommended before freezing, with 50% being optimal for long-term storage . Glycerol prevents ice crystal formation that could denature the protein.

• Aliquoting: Divide purified protein into small single-use aliquots before freezing to avoid repeated freeze-thaw cycles which significantly reduce protein activity and structural integrity .

• Reconstitution: For lyophilized preparations, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL just before use .

It is strongly advised to avoid repeated freeze-thaw cycles as they cause significant protein denaturation, particularly for transmembrane proteins like YcaP that have complex structural requirements.

What analytical methods can be used to characterize recombinant YcaP?

Comprehensive characterization of recombinant YcaP requires multiple complementary techniques:

• SDS-PAGE analysis: Primary method for assessing purity, molecular weight verification, and initial quality control . Typical results should show a single predominant band at approximately 25-27 kDa (accounting for the His-tag addition to the 230 aa protein).

• Western blotting: Confirms protein identity using anti-His antibodies or specific anti-YcaP polyclonal antibodies . This technique is particularly valuable when working with complex samples or low expression levels.

• Mass spectrometry: Provides precise molecular weight determination and can verify the complete amino acid sequence through peptide mapping after proteolytic digestion.

• Circular dichroism (CD) spectroscopy: Evaluates secondary structure composition to confirm proper folding, particularly important for transmembrane proteins which should exhibit characteristic α-helical signatures.

• Dynamic light scattering (DLS): Assesses protein homogeneity and checks for aggregation, critical for determining suitable conditions for structural studies.

• Functional assays: Though specific functional assays for YcaP remain limited due to incomplete understanding of its biological role, general membrane protein incorporation assays using liposomes or nanodiscs can verify proper membrane insertion.

These methods should be employed sequentially during purification optimization to ensure that the recombinant protein maintains its native-like properties throughout the expression and purification process.

What challenges are specific to expressing transmembrane proteins like YcaP in E. coli?

Expression of transmembrane proteins like YcaP presents unique challenges that require specialized approaches:

• Cellular toxicity: Overexpression of membrane proteins often leads to toxicity through several mechanisms, including membrane integrity disruption, secretion pathway overloading, and competition for cellular translocation machinery . This toxicity manifests as growth inhibition, reduced final cell density, and selection pressure for mutations that reduce expression.

• Transcription and translation balance: Excessive amounts of recombinant mRNA driven by strong promoters like T7 can outcompete endogenous mRNA for ribosomes, impairing synthesis of essential proteins . This ribosomes sequestration represents a critical bottleneck in the expression of membrane proteins.

• Protein folding limitations: Proper insertion of YcaP into membranes requires the signal recognition particle (SRP) pathway and translocon machinery, both of which have limited capacity and can become saturated during overexpression.

• Aggregation tendency: When membrane insertion machinery becomes overwhelmed, hydrophobic transmembrane segments of YcaP are exposed to the cytoplasm, leading to aggregation and inclusion body formation.

• T7 RNA polymerase toxicity: High expression levels driven by the T7 system can trigger an adaptive response in E. coli, leading to selection of mutants with decreased or no T7 RNA polymerase activity . This evolutionary pressure explains why using lower IPTG concentrations (<0.1 mM) can sometimes improve yields by reducing selective pressure.

These challenges necessitate careful optimization of expression parameters, including induction timing, temperature, culture media composition, and inducer concentration. The development of specialized strains with enhanced membrane protein expression capabilities represents an active area of research.

How does the metabolic burden affect YcaP production and how can it be minimized?

Metabolic burden during recombinant YcaP expression represents a complex phenomenon with significant implications for protein yield and quality:

• Definition and impacts: Metabolic burden manifests as growth retardation, reduction in biomass yield, and decreased cell viability when cellular resources are redirected toward recombinant protein production . For YcaP expression, this burden is particularly pronounced due to the energy requirements for membrane insertion.

• Resource competition mechanisms:

  • Transcriptional burden: High-copy plasmids and strong promoters consume nucleotides and transcriptional machinery

  • Translational burden: Limited ribosome availability becomes critical when expressing membrane proteins

  • Energy diversion: ATP consumption for protein synthesis and membrane insertion competes with essential cellular processes

  • Redox balance disruption: Membrane protein folding can influence cellular redox state

• Minimization strategies:

  • Use tunable promoters instead of constitutive ones to control expression rate

  • Employ lower copy number plasmids to reduce gene dosage effects

  • Implement auto-induction media that gradually activates expression

  • Utilize slower growth conditions (lower temperature, minimal media) to better balance resources

  • Apply mathematical modeling to predict optimal induction timing based on growth phase

• Contradictory findings: Research reveals contradictory results regarding what truly constitutes the limiting factor in recombinant expression . Some studies suggest mRNA abundance is the primary bottleneck, while others point to protein folding machinery limitations or energy depletion.

• Monitoring approaches: Researchers should implement real-time monitoring of growth curves, protein synthesis rates, and cellular stress responses (heat shock proteins, proteases upregulation) to identify the specific limiting factors in their expression system.

The development of artificial intelligence tools to model and predict metabolic burden offers promising avenues for optimization, though systematic experimental data collection remains necessary to train effective models .

What role do disulfide bonds play in YcaP expression and how can their formation be optimized?

Disulfide bond formation represents a critical consideration in the production of properly folded YcaP protein:

• Disulfide bond presence: Analysis of the YcaP sequence reveals cysteine residues that potentially form disulfide bonds, particularly in the C-terminal region (CSEIIHMKAGEKQLCPRCANPEWTKASRAKRVT) . Proper formation of these bonds is essential for structural integrity.

• Cytoplasmic redox environment challenges: The strongly reducing environment of wild-type E. coli cytoplasm typically prevents disulfide bond formation . When expressing YcaP in standard BL21(DE3) strains, disulfide bonds may form incorrectly or not at all.

• Strategic approaches for optimization:

  Approach	Mechanism	Advantages	Limitations
  Origami strain utilization	Mutations in thioredoxin reductase (trxB) and glutathione reductase (gor) genes create oxidizing cytoplasm	Established system with commercial availability	Slower growth rates
  Sulfhydryl oxidase co-expression	Direct catalysis of disulfide bond formation	Effective even in reducing environments	Requires co-expression optimization
  Phosphate depletion system	Triggers switch from reducing to oxidizing conditions during stationary phase	Temporal control over redox conditions	Requires careful media formulation
  Periplasmic expression	Naturally oxidizing environment favors disulfide formation	Natural pathway for many secreted proteins	Lower yields than cytoplasmic expression

• Post-purification oxidation: Interestingly, some research indicates that disulfide bonds may form during the purification process itself, particularly when fusion partners like GFP prevent aggregation until oxidation can occur .

• Monitoring disulfide formation: Researchers should implement Ellman's reagent assays or mass spectrometry with and without reducing agents to verify correct disulfide bond formation.

The optimal approach depends on the specific research objectives, with the switchable redox environment triggered by phosphate depletion representing the most recent innovation for controlling disulfide bond formation timing .

How can protein aggregation during YcaP expression be controlled or prevented?

Controlling aggregation of transmembrane proteins like YcaP requires multiple strategic approaches:

Researchers should implement systematic screening of these conditions using techniques like fluorescence-detection size exclusion chromatography (FSEC) or light scattering to quantitatively assess aggregation under each condition.

How does the T7 RNA polymerase system affect YcaP expression and what optimization strategies exist?

The T7 RNA polymerase system presents both advantages and challenges for YcaP expression that require careful consideration:

• System characteristics: The T7 system utilizes bacteriophage T7 RNA polymerase, typically under the control of the lacUV5 promoter, to drive expression from T7 promoters on expression vectors . This system produces approximately 5 times more mRNA than E. coli RNA polymerase, potentially leading to very high protein expression.

• Challenges specific to YcaP expression:

  • Excessive mRNA production can outcompete endogenous mRNA for ribosomes

  • Resource allocation imbalances create selective pressure for mutations that reduce T7 RNA polymerase activity

  • The high translation rate can overwhelm membrane insertion machinery

  • Cell toxicity increases with IPTG concentrations above 0.1 mM

• Key optimization strategies:

  Parameter	Optimization Approach	Rationale
  IPTG concentration	Use 0.01-0.1 mM instead of standard 1 mM	Reduces toxicity and selective pressure for mutations
  Induction timing	Induce at mid-log phase (OD600 0.6-0.8)	Ensures robust cellular machinery before expression burden
  Temperature shift	Reduce to 15-25°C upon induction	Slows translation rate to match membrane insertion capacity
  Media composition	Use complex media with glucose control	Prevents leaky expression and provides adequate nutrients
  Vector selection	Consider pLysS strains or tunable promoters	Reduces basal expression and provides tighter control

• Alternative approaches:

  • Auto-induction media: Gradually activates expression as glucose is depleted

  • T7-based cell-free expression systems: Eliminates viability constraints

  • Arabinose-inducible (pBAD) or tetracycline-inducible systems: Provide more finely tuned expression control

• Monitoring for mutations: Researchers should verify plasmid integrity and sequence after expression to ensure the absence of mutations that reduce expression capacity .

The ideal T7 expression protocol for YcaP balances protein yield against quality, with lower induction levels often producing better-folded protein despite apparently reducing total expression.

What advanced structural characterization methods are suitable for YcaP?

Comprehensive structural characterization of transmembrane proteins like YcaP requires specialized approaches:

• Cryo-electron microscopy (cryo-EM): Particularly valuable for membrane proteins, cryo-EM allows visualization of YcaP structure in near-native environments without crystallization. Sample preparation typically involves reconstitution into nanodiscs or liposomes. Recent advances in direct electron detectors and image processing have improved resolution to near-atomic levels.

• X-ray crystallography challenges and solutions:

  • Lipidic cubic phase (LCP) crystallization: Creates membrane-mimetic environment conducive to YcaP crystallization

  • Surface engineering: Introduction of fusion proteins (e.g., T4 lysozyme) into loop regions to increase hydrophilic surface area for crystal contacts

  • Antibody fragment co-crystallization: Fab fragments can provide additional crystal contacts

• Nuclear Magnetic Resonance (NMR) approaches:

  • Solution NMR: Limited to smaller membrane proteins or domains, utilizing detergent micelles

  • Solid-state NMR: No size limitations, can be performed on YcaP in lipid bilayers

  • Selective isotope labeling: Incorporation of 15N, 13C at specific residues to probe functional sites

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Maps solvent-accessible regions and dynamics

  • Identifies transmembrane domains by their protection from exchange

  • Detects conformational changes under different conditions

• Crosslinking mass spectrometry (XL-MS):

  • Identifies proximity relationships between amino acids

  • Particularly valuable for defining tertiary structure

  • Compatible with various membrane-mimetic environments

• Molecular dynamics (MD) simulations:

  • Predicts YcaP behavior in membrane environments

  • Models conformational changes and dynamics

  • Requires experimental validation of key predictions

Integration of multiple techniques provides complementary information, with initial low-resolution structural models from computational prediction serving as scaffolds for experimental refinement. For YcaP specifically, its 230-amino acid size and multiple transmembrane domains make cryo-EM and solid-state NMR particularly promising approaches.

How do glycosylation pathways in E. coli affect recombinant YcaP production?

Recent advances in E. coli glycosylation systems offer new considerations for YcaP expression:

• Native glycosylation status: Wild-type E. coli possesses limited glycosylation machinery compared to eukaryotic systems. While YcaP is not naturally glycosylated in E. coli, engineered glycosylation pathways may impact expression and stability.

• Engineered glycosylation pathways: Recent developments have established functional glycosylation pathways in E. coli through:

  • Protein Glycan Coupling Technology (PGCT): Enabling in vivo coupling of recombinant glycan antigens to carrier proteins

  • Oligosaccharyltransferase expression: Catalyzing glycan transfer to target proteins

• Impacts on membrane protein expression:

  • Increased solubility: Glycosylation can enhance folding and reduce aggregation

  • Altered membrane insertion: Glycans may affect translocation efficiency

  • Stability enhancement: N-linked glycans can stabilize protein conformations

  • Expression modulation: Glycosylation machinery competes for cellular resources

• Optimization considerations:

  • Glycan building block availability: Limited undecaprenyl phosphate can restrict glycosylation efficiency

  • Strain engineering: Specialized strains with optimized glycosylation pathways

  • Process automation: Systematic comparison of different culture conditions

• Application relevance:

  • When YcaP serves as a model membrane protein: Glycosylation impact studies inform broader membrane protein expression strategies

  • When functional studies are primary: Native non-glycosylated form may be preferred

  • For immunological applications: Glycoconjugate forms may provide enhanced properties

While native YcaP does not require glycosylation for function, researchers exploring novel production approaches should consider the potential benefits of engineered glycosylation pathways for enhancing solubility and stability during expression and purification processes.

How can artificial intelligence tools help in optimizing recombinant YcaP expression?

Artificial intelligence approaches offer promising solutions to the complex multifactorial optimization challenges in YcaP expression:

• Machine learning applications:

  • Expression condition prediction: Algorithms trained on historical expression data can predict optimal temperature, media composition, and induction parameters

  • Sequence-based folding prediction: Neural networks forecast how sequence modifications impact YcaP folding efficiency

  • Process optimization: Reinforcement learning models can direct real-time adjustments during fermentation

• Current limitations and requirements:

  • Data standardization needs: Systematic experimental approaches and uniform data collection formats are required for effective model training

  • Parameter interdependence: Complex relationships between expression variables necessitate sophisticated modeling approaches

  • Validation requirements: AI predictions require experimental validation in diverse expression systems

• Practical implementation approaches:

  • Hybrid models: Combining mechanistic understanding with machine learning

  • Transfer learning: Leveraging models trained on other membrane proteins to predict YcaP behavior

  • Active learning: Iterative experimental design guided by model uncertainties

• Example applications for YcaP:

  • Codon optimization: AI tools can design synthetic YcaP genes with optimized codon usage for E. coli expression

  • Mutation prediction: Identifying stabilizing mutations that enhance YcaP expression yield

  • Culture parameter optimization: Determining ideal media formulation, feeding strategies, and induction timing

• Future directions:

  • Integration with automated high-throughput expression platforms

  • Incorporation of multi-omics data (transcriptomics, proteomics, metabolomics)

  • Development of explainable AI models that provide mechanistic insights

Despite the promising potential, current AI applications in this field require more systematic experimental data collection to overcome the contradictory and fragmented nature of existing research findings . Integration of AI with automated laboratory systems represents a particularly promising direction for YcaP expression optimization.

What contradictory findings exist regarding recombinant protein expression in E. coli and how do they affect YcaP research?

Significant contradictions in the literature create challenges for optimizing YcaP expression:

• Metabolic burden mechanism controversies:

  • mRNA abundance hypothesis: Some research indicates excessive mRNA production from T7 promoters is the primary bottleneck

  • Protein toxicity hypothesis: Contradictory findings suggest the accumulation of misfolded protein triggers toxicity

  • Resource limitation models: Alternative explanations focus on depletion of specific cellular components

• Expression strategy contradictions:

  Conflicting Approaches	Supporting Evidence	Contradicting Evidence
  High vs. low IPTG concentration	High IPTG maximizes protein yield	Low IPTG (<0.1 mM) reduces mutation pressure and may increase active protein yield
  Cytoplasmic vs. periplasmic expression	Cytoplasmic expression provides higher yields	Periplasmic targeting facilitates proper disulfide bond formation
  Early vs. late induction timing	Early induction maximizes production window	Late induction ensures adequate biomass before metabolic burden

• Contradictory findings on disulfide bond formation:

  • Unexpected findings show HDPs expressed in wild-type BL21(DE3) accumulated with correctly formed disulfide bonds despite reducing cytoplasm

  • This contradicts the established requirement for oxidizing environments

  • Suggests disulfide bond formation may occur during purification rather than in vivo

• Mutation selection controversies:

  • Evidence suggests high expression creates selection pressure for mutations reducing T7 RNA polymerase activity

  • Raises questions about whether proteins obtained using standard protocols come from wildtype or mutant populations

  • Creates uncertainty about reproducibility of published protocols

• Implications for YcaP research:

  • Need for careful protocol documentation and strain verification

  • Importance of monitoring for mutations during expression

  • Value of comparing multiple expression approaches rather than relying on single methods

These contradictions highlight the need for more systematic approaches to protein expression research, including standardized reporting formats and comprehensive characterization of expression conditions. For YcaP specifically, researchers should implement multiple expression strategies in parallel to identify optimal conditions for their specific experimental requirements.

What experimental design considerations are critical for studying YcaP function?

Designing robust experiments to investigate YcaP function requires careful consideration of multiple factors:

When investigating proteins like YcaP with unclear native functions, parallel approaches combining computational predictions with multiple experimental methodologies provide the most robust framework for functional characterization. Researchers should systematically test multiple hypotheses rather than focusing on a single predicted function.