Recombinant Escherichia coli UPF0716 protein fxsA (fxsA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
fxsA; yjeG; b4140; JW4100; UPF0716 protein FxsA; Suppressor of F exclusion of phage T7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
fxsA
Target Protein Sequence
MRWLPFIAIFLYVYIEISIFIQVAHVLGVLLTLVLVIFTSVIGMSLVRNQGFKNFVLMQQ KMAAGENPAAEMIKSVSLIIAGLLLLLPGFFTDFLGLLLLLPPVQKHLTVKLMPHLRFSR MPGGGFSAGTGGGNTFDGEYQRKDDERDRLDHKDDRQD
Uniprot No.

Target Background

Function
Overexpression of this protein mitigates the exclusion of phage T7 in cells possessing the F plasmid.
Database Links
Protein Families
UPF0716 (FxsA) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fxsA protein in Escherichia coli and what is its relationship to cell division?

The fxsA protein (UPF0716) in E. coli is part of the cellular machinery involved in stress response and potentially plays a role in cell division processes. While the direct function of fxsA remains under investigation, it appears to be related to the stress response pathways that are activated during recombinant protein overproduction. During high-cell-density cultures of E. coli, overproduction of recombinant proteins often leads to increased stress response, cell filamentation, and growth cessation . The fxsA protein may be involved in mediating these responses, particularly in conjunction with the FtsA and FtsZ proteins, which are key components in the cell division process.

How does fxsA expression correlate with bacterial growth and recombinant protein production?

Current research suggests that fxsA expression levels may correlate with bacterial growth characteristics during recombinant protein production. In high-cell-density cultivation (HCDC) of E. coli, cells often undergo filamentation when producing recombinant proteins at high levels, which consequently lowers the final achievable cell concentration and productivity of the target protein . The expression of fxsA may be modulated under these conditions as part of the cellular stress response. Researchers have observed that proper management of division-related genes (such as ftsA and ftsZ) can significantly improve both the specific growth rate of recombinant E. coli and the volumetric productivity of recombinant proteins .

What experimental systems are commonly used to study fxsA function in E. coli?

Common experimental systems for studying fxsA function include:

  • Gene expression analysis using quantitative PCR or RNA-Seq to measure fxsA mRNA levels under various growth conditions

  • Protein localization studies using fxsA-GFP fusion constructs

  • Gene knockout or knockdown studies to evaluate the effects of fxsA absence

  • Co-expression studies with related proteins (such as FtsA and FtsZ) to identify functional interactions

  • High-cell-density cultivation (HCDC) systems to assess the role of fxsA during industrial-scale protein production

These approaches can be complemented by microscopic observation of cell morphology to detect filamentation or other cellular abnormalities that may result from altered fxsA expression or function .

What are the optimal conditions for inducing and purifying recombinant fxsA protein?

For optimal induction and purification of recombinant fxsA protein, researchers should consider the following methodological approach:

  • Vector Selection: Use of expression vectors with strong, inducible promoters such as T7 or trc promoters

  • Host Strain Selection: E. coli BL21(DE3) or similar strains deficient in certain proteases

  • Co-expression Strategy: Consider co-expressing the ftsA and ftsZ genes, as this approach has been shown to suppress filamentation and improve protein production

  • Induction Parameters:

    • Temperature: 30°C after induction (to reduce inclusion body formation)

    • IPTG concentration: 0.1-0.5 mM (adjusted based on preliminary experiments)

    • Induction timing: Mid-log phase (OD600 of 0.6-0.8)

  • Purification Method: Affinity chromatography using His-tag or other fusion tags

This methodology takes into account that during overproduction of recombinant proteins, E. coli cells often undergo stress responses leading to filamentation. Co-expression of cell division genes like ftsA and ftsZ has been demonstrated to suppress this filamentation, resulting in improved growth rates and protein production .

How can researchers address the challenge of cell filamentation when overexpressing fxsA or related proteins?

Cell filamentation is a common challenge in recombinant protein production that can significantly impact productivity. To address this issue when working with fxsA or related proteins, researchers can implement the following strategies:

  • Co-expression of Cell Division Genes: Co-expressing the E. coli ftsA and ftsZ genes has been shown to successfully suppress filamentation caused by the accumulation of recombinant proteins. This approach can increase both the specific growth rate of recombinant E. coli (by approximately 1.3-fold) and the volumetric productivity of the target protein (by approximately 2-fold) .

  • Optimizing Gene Expression Ratios: Maintain appropriate expression ratios between fxsA and other division-related proteins. Research has shown that for proper cell division, the fts gene products must be present at appropriate levels, with a proper ratio of FtsA to FtsZ (approximately 1:100) required for active cell division .

  • Vector Construction: Design plasmid constructs that constitutively co-express multiple division-related genes. For example, a plasmid constitutively co-expressing both the E. coli ftsA and ftsZ genes can be constructed using appropriate promoters and cloning strategies .

  • Growth Condition Optimization: Monitor and adjust cultivation parameters such as temperature, pH, dissolved oxygen, and nutrient concentrations to minimize stress responses that exacerbate filamentation.

  • Microscopic Monitoring: Regularly assess cell morphology through microscopy to determine the effectiveness of anti-filamentation strategies and make necessary adjustments to the experimental protocol.

ParameterWithout ftsA/ftsZ Co-expressionWith ftsA/ftsZ Co-expressionImprovement
Specific Growth Rate~0.10 h⁻¹~0.13 h⁻¹1.3-fold
Maximum Cell ConcentrationLower~27.5 g DCW/literSignificant
Protein Production OnsetDelayedEarlier (16 h)Improved
Volumetric Productivity~0.04 g/liter/h~0.08 g/liter/h2-fold
Cell MorphologyFilamentousNormal shape and lengthNormalized

What advanced molecular techniques can be applied to investigate fxsA interactions with other cellular components?

To investigate fxsA interactions with other cellular components, several advanced molecular techniques can be employed:

  • Protein-Protein Interaction Studies:

    • Bacterial two-hybrid system

    • Co-immunoprecipitation followed by mass spectrometry

    • Förster resonance energy transfer (FRET) analysis

    • Bimolecular fluorescence complementation (BiFC)

  • Genomic Approaches:

    • ChIP-seq to identify potential DNA binding sites

    • RNA-seq to assess transcriptome changes in fxsA mutants

    • Ribosome profiling to examine translation effects

  • Structural Biology:

    • X-ray crystallography or cryo-EM to determine protein structure

    • NMR spectroscopy for structural dynamics

    • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

  • Functional Genomics:

    • CRISPR interference (CRISPRi) for targeted gene repression

    • Transposon sequencing (Tn-seq) to identify genetic interactions

    • Synthetic genetic array analysis to map genetic networks

  • Live Cell Imaging:

    • Time-lapse fluorescence microscopy with fluorescently tagged fxsA

    • Super-resolution microscopy techniques (STORM, PALM)

    • Single-molecule tracking to monitor protein dynamics

These techniques, especially when used in combination, can provide comprehensive insights into the molecular function of fxsA and its interaction partners in the context of cell division and stress responses during recombinant protein production .

What are the common pitfalls in studying fxsA function and how can they be overcome?

Several challenges frequently arise when studying fxsA function, along with recommended solutions:

  • Protein Solubility Issues:

    • Challenge: fxsA protein may form inclusion bodies when overexpressed

    • Solution: Optimize expression conditions (lower temperature, reduced inducer concentration); use solubility-enhancing fusion tags; co-express with molecular chaperones

  • Filamentation Effects:

    • Challenge: Overexpression of fxsA or related proteins can cause cell filamentation, confounding experimental results

    • Solution: Co-express with ftsA and ftsZ genes to maintain proper cell division; monitor cell morphology throughout experiments; consider using strains with enhanced tolerance to protein overproduction

  • Inconsistent Expression Levels:

    • Challenge: Variable expression of fxsA between experiments

    • Solution: Use tightly regulated expression systems; standardize induction protocols; validate expression levels by Western blotting

  • Functional Redundancy:

    • Challenge: Compensatory mechanisms may mask fxsA phenotypes

    • Solution: Create multiple gene knockout combinations; use conditional depletion systems; perform experiments under stress conditions that may reveal phenotypes

  • Protein-Protein Interaction Detection:

    • Challenge: Transient or weak interactions may be difficult to detect

    • Solution: Use in vivo crosslinking approaches; employ proximity labeling methods; optimize buffer conditions for maintaining interactions during purification

How can contradicting experimental results regarding fxsA function be reconciled?

When facing contradicting experimental results regarding fxsA function, researchers should consider the following analytical approach:

  • Experimental Context Evaluation:

    • Compare the specific E. coli strains used across studies

    • Assess differences in growth conditions and media composition

    • Examine the recombinant protein being produced (size, hydrophobicity, toxicity)

    • Consider the expression vector systems and their regulation mechanisms

  • Methodological Differences Analysis:

    • Create a comprehensive table comparing key methodological parameters across studies

    • Reproduce experiments using standardized protocols

    • Perform side-by-side comparisons under identical conditions

  • Genetic Background Consideration:

    • Test the effect of fxsA in multiple genetic backgrounds

    • Create isogenic strains differing only in the fxsA gene

    • Consider the presence of suppressor mutations that may arise

  • Protein Stoichiometry Assessment:

    • Evaluate the ratio of fxsA to interaction partners like FtsA and FtsZ

    • Remember that proper ratios (e.g., FtsA:FtsZ at 1:100) are critical for normal cell division

    • Quantify absolute protein levels using calibrated Western blotting or mass spectrometry

  • Integrated Data Analysis:

    • Apply statistical meta-analysis techniques to published data

    • Develop mathematical models to explain apparently contradictory results

    • Consider that fxsA may have different functions under different conditions

What future research directions might yield the most significant insights about fxsA protein function?

Based on current knowledge gaps and emerging technologies, the following research directions may yield significant insights about fxsA protein function:

  • Systems Biology Approaches:

    • Multi-omics integration (proteomics, transcriptomics, metabolomics) to understand fxsA in the context of global cellular responses

    • Network analysis to position fxsA within bacterial stress response pathways

    • Flux balance analysis to quantify the impact of fxsA expression on cellular metabolism

  • Structural Biology Investigations:

    • Determine the high-resolution structure of fxsA alone and in complex with interaction partners

    • Conduct molecular dynamics simulations to understand conformational changes

    • Perform structure-guided mutagenesis to identify critical functional domains

  • Synthetic Biology Applications:

    • Engineer fxsA variants with enhanced properties for recombinant protein production

    • Develop synthetic genetic circuits incorporating fxsA to control cell division

    • Create biosensors based on fxsA to monitor cellular stress in real-time

  • Comparative Genomics Studies:

    • Analyze fxsA homologs across bacterial species to identify conserved functional domains

    • Investigate evolutionary patterns to understand fxsA adaptation to different ecological niches

    • Perform complementation studies with homologs to identify species-specific functions

  • Application in Biotechnology:

    • Explore the potential of fxsA manipulation to enhance production of difficult-to-express proteins

    • Investigate the use of fxsA in combination with ftsA and ftsZ to create improved host strains for biotechnology

    • Develop fxsA-based strategies to control bacterial growth in continuous cultivation systems

How can fxsA be utilized to improve recombinant protein production in E. coli?

Based on our understanding of stress responses in E. coli during recombinant protein production, fxsA manipulation presents several potential strategies for improving protein yields:

  • Optimized Expression Systems:

    • Design expression vectors that co-express fxsA alongside cell division genes (ftsA/ftsZ)

    • Create host strains with modified fxsA expression to better tolerate protein overproduction

    • Develop inducible systems that coordinate fxsA expression with recombinant protein production

  • Stress Response Management:

    • Modulate fxsA levels to mitigate stress responses during high-density cultivation

    • Couple fxsA expression to stress-sensing promoters for dynamic response

    • Create feedback circuits that adjust fxsA levels based on cellular growth parameters

  • Cell Morphology Control:

    • Utilize fxsA in combination with ftsA and ftsZ to prevent filamentation

    • Maintain proper gene expression ratios (remember FtsA:FtsZ ratio of 1:100 is critical)

    • Implement microscopy-based feedback systems to monitor and adjust cell morphology

A practical implementation approach could involve a two-plasmid system:

  • Plasmid 1: Containing the target recombinant protein under an inducible promoter

  • Plasmid 2: Containing fxsA, ftsA, and ftsZ genes under constitutive or auto-regulated promoters

This system, similar to the approach used with pACfAZ2 for ftsA/ftsZ co-expression , would help maintain normal cell division while allowing high-level expression of the target protein.

What experimental design would best elucidate the molecular mechanism of fxsA in bacterial stress response?

A comprehensive experimental design to elucidate fxsA's molecular mechanism in bacterial stress response should include:

  • Genetic Manipulation Series:

    • Create precise knockout, knockdown, and overexpression strains

    • Construct complementation strains with wild-type and mutated versions

    • Develop inducible depletion systems to study acute effects

  • Stress Challenge Battery:

    • Subject strains to various stressors (heat shock, oxidative stress, nutrient limitation)

    • Test recombinant protein overexpression with model proteins of varying properties

    • Examine high-cell-density cultivation responses

  • Multi-level Analysis Pipeline:

Analysis LevelTechniquesExpected Outcomes
TranscriptomeRNA-seq, qRT-PCRIdentify genes co-regulated with fxsA
ProteomeMass spectrometry, Western blottingQuantify protein level changes
InteractomeCo-IP/MS, bacterial two-hybridMap interaction partners
MetabolomeLC-MS, NMR metabolomicsDetect metabolic shifts
Cell BiologyTime-lapse microscopy, flow cytometryObserve morphological changes
PhysiologyGrowth curves, viability assaysMeasure fitness impacts
  • Temporal Resolution Studies:

    • Perform time-course experiments following stress induction

    • Use synchronized cell populations to examine cell-cycle dependence

    • Implement real-time reporters to track dynamic changes

  • Comparative Analysis:

    • Compare fxsA responses to those of known stress response genes

    • Examine additive or synergistic effects with other stress pathways

    • Conduct epistasis analysis to position fxsA within stress response hierarchies

This integrated approach would provide a comprehensive understanding of fxsA's role, particularly in the context of cell division and stress responses during recombinant protein production .

How should researchers design controls when studying the effects of fxsA manipulation on E. coli physiology?

Proper control design is crucial for obtaining reliable data when studying fxsA effects. Researchers should implement the following control strategies:

  • Genetic Controls:

    • Empty vector controls (same backbone as fxsA expression vectors)

    • Expression of unrelated proteins of similar size/properties

    • Isogenic strains differing only in fxsA status

    • Complementation controls with wild-type fxsA

  • Expression Level Controls:

    • Titration of inducer concentrations to match protein levels

    • Western blot verification of expression levels

    • Use of constitutive markers to normalize for cell number/volume

    • qPCR verification of transcript levels

  • Physiological State Controls:

    • Standardization of starting cell density and growth phase

    • Parallel cultures grown under identical conditions

    • Monitoring of key physiological parameters (pH, dissolved oxygen)

    • Growth curve characterization before specific assays

  • Experimental Design Controls:

    • Randomization of sample processing order

    • Blinding of sample identity during analysis when possible

    • Technical and biological replicates (minimum n=3)

    • Inclusion of positive controls with known phenotypes

  • Stress Response Baseline Controls:

    • Characterization of normal stress responses without fxsA manipulation

    • Measurement of standard stress markers (heat shock proteins, ROS levels)

    • Comparison with well-characterized stress response mutants

    • Time-matched sampling to account for growth phase effects

When studying cell filamentation specifically, researchers should include controls such as ftsZ-only expression strains, which have been shown to still undergo filamentation, as compared to the successful suppression of filamentation with co-expression of both ftsA and ftsZ genes .

What statistical approaches are most appropriate for analyzing complex phenotypic data related to fxsA function?

When analyzing complex phenotypic data related to fxsA function, researchers should consider these statistical approaches:

  • Multifactorial Analysis Techniques:

    • ANOVA with post-hoc tests for comparing multiple experimental conditions

    • Mixed-effects models for experiments with both fixed and random effects

    • Multivariate analysis (PCA, clustering) to identify patterns across multiple parameters

    • Time series analysis for growth curves and dynamic responses

  • Non-parametric Approaches:

    • Kruskal-Wallis and Mann-Whitney U tests when data doesn't meet normality assumptions

    • Permutation tests for complex experimental designs

    • Bootstrap resampling to establish confidence intervals

  • Correlation Analysis:

    • Pearson or Spearman correlation to identify relationships between parameters

    • Partial correlation to control for confounding variables

    • Network correlation analysis for multi-omics data integration

  • Specialized Analyses for Specific Data Types:

    • Cell morphology: Image analysis algorithms with appropriate statistical tests

    • Growth parameters: Growth curve fitting with parameter extraction and comparison

    • Protein production: Kinetic modeling with parameter estimation

  • Effect Size Quantification:

    • Cohen's d or similar metrics to quantify the magnitude of effects

    • Confidence intervals for parameter estimates

    • Power analysis to ensure adequate sample sizes

For example, when analyzing improvements in protein production due to fxsA manipulation alongside ftsA/ftsZ co-expression, researchers could apply paired statistical tests to compare before/after conditions, with careful consideration of both the statistical significance and the magnitude of the effect (such as the observed 1.3-fold increase in growth rate and 2-fold increase in volumetric productivity) .

How can researchers distinguish between direct and indirect effects of fxsA on cellular physiology?

Distinguishing between direct and indirect effects of fxsA on cellular physiology requires a systematic approach:

  • Temporal Resolution Studies:

    • Conduct high-resolution time-course experiments after fxsA perturbation

    • Apply mathematical modeling to identify primary vs. secondary responses

    • Use rapid induction/repression systems to capture immediate effects

  • Proximity-Based Approaches:

    • Implement BioID or APEX2 proximity labeling to identify proteins in close physical association with fxsA

    • Use crosslinking mass spectrometry to capture direct interaction partners

    • Apply ChIP-seq if fxsA has DNA-binding properties

  • Genetic Interaction Mapping:

    • Perform synthetic genetic array analysis to identify genes that interact with fxsA

    • Use epistasis analysis to order genes in pathways

    • Apply CRISPR interference screens to identify genetic dependencies

  • Biochemical Validation:

    • Reconstitute potential direct interactions in vitro

    • Perform enzyme assays to test direct biochemical activities

    • Use purified components to verify mechanistic hypotheses

  • Comparative Analysis Framework:

    • Compare phenotypic signatures across multiple perturbations

    • Identify shared vs. unique responses

    • Construct causal networks based on intervention studies

When examining the relationship between fxsA and cell division proteins like FtsA and FtsZ, researchers should consider that proper protein ratios are essential for normal function, suggesting complex regulatory relationships rather than simple linear interactions .

What are the most important considerations when translating findings on fxsA from laboratory strains to industrial E. coli production strains?

When translating findings on fxsA from laboratory to industrial strains, researchers should consider:

  • Strain Background Differences:

    • Genetic variations between laboratory and industrial strains

    • Presence of mutations that may affect fxsA function

    • Adaptation to high-density growth conditions

    • Compatibility with existing production plasmids

  • Scale-Up Considerations:

    • Effects of bioreactor conditions vs. laboratory cultures

    • Impact of dissolved oxygen gradients and mixing on fxsA function

    • Stability of genetic constructs during extended cultivation

    • Reproducibility of fxsA effects across different scales

  • Process Integration:

    • Compatibility with existing induction protocols

    • Effects on downstream processing and product quality

    • Regulatory and safety considerations for modified strains

    • Cost-benefit analysis of implementing fxsA modifications

  • Robustness Assessment:

    • Sensitivity to raw material variations

    • Performance across different media formulations

    • Stability over multiple generations and production runs

    • Stress tolerance under industrial conditions

  • Optimization Framework:

    • Design of experiments approach for process optimization

    • Multivariate analysis to identify critical parameters

    • Feedback control strategies based on real-time monitoring

    • Continuous improvement cycle with iterative testing

For example, when implementing ftsA/ftsZ co-expression systems that have shown benefits in laboratory settings, industrial applications would require careful optimization of expression levels and evaluation of long-term genetic stability, while ensuring that the improvements in growth rate (1.3-fold) and productivity (2-fold) observed in controlled settings can be maintained under industrial conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.