Recombinant Escherichia coli Voltage-gated potassium channel Kch (kch)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
kch; b1250; JW1242; Voltage-gated potassium channel Kch
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-417
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
kch
Target Protein Sequence
MSHWATFKQTATNLWVTLRHDILALAVFLNGLLIFKTIYGMSVNLLDIFHIKAFSELDLS LLANAPLFMLGVFLVLNSIGLLFRAKLAWAISIILLLIALIYTLHFYPWLKFSIGFCIFT LVFLLILRKDFSHSSAAAGTIFAFISFTTLLFYSTYGALYLSEGFNPRIESLMTAFYFSI ETMSTVGYGDIVPVSESARLFTISVIISGITVFATSMTSIFGPLIRGGFNKLVKGNNHTM HRKDHFIVCGHSILAINTILQLNQRGQNVTVISNLPEDDIKQLEQRLGDNADVIPGDSND SSVLKKAGIDRCRAILALSDNDADNAFVVLSAKDMSSDVKTVLAVSDSKNLNKIKMVHPD IILSPQLFGSEILARVLNGEEINNDMLVSMLLNSGHGIFSDNDELETKADSKESAQK
Uniprot No.

Target Background

Function
K(+)-specific ion channel. May play a role in the defense against osmotic shock.
Gene References Into Functions
  1. The structure of Kch, a channel of this type from Escherichia coli, in a lipid environment using electron crystallography. PMID: 25497729
Database Links
Protein Families
Potassium channel family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Kch and how is it structurally related to eukaryotic potassium channels?

Kch is a prokaryotic voltage-gated potassium channel homologue encoded by the kch gene, which is the only potassium channel gene identified in Escherichia coli . Structurally, Kch shares significant homology with eukaryotic voltage-gated potassium channels, particularly in terms of its basic architecture . The protein belongs to the class of voltage-gated potassium channels characterized by six transmembrane segments per subunit and modulation directly by membrane potential .

The protein exists physiologically as a homotetramer, consisting of four identical ~50 kDa monomeric subunits that assemble to form a functional channel . This tetrameric structure is consistent with the quaternary organization of eukaryotic potassium channels, suggesting evolutionary conservation of this fundamental structural arrangement. CD spectroscopy analysis of purified Kch indicates a significant α-helical content that remains preserved even upon addition of detergents like SDS, further confirming structural similarities with eukaryotic counterparts .

What domains comprise the Kch protein, and what are their functional significance?

The Kch protein contains two major functional domains: a transmembrane domain that forms the ion-conducting pore and a cytosolic regulatory domain known as RCK (Regulator of K+ Conductance) . Interestingly, the kch gene has the unique property of expressing both full-length Kch and its cytosolic RCK domain separately, due to the presence of a methionine residue at position 240 that can serve as an alternative translation initiation site .

The RCK domains are believed to form an octameric ring structure that regulates the gating of potassium channels upon binding specific ligands . This regulatory mechanism represents a sophisticated control system for channel activity. The transmembrane domain contains the selectivity filter that determines ion specificity, allowing potassium ions to pass while excluding other ions. Together, these domains establish the dual functionality of Kch as both an ion conductor and a regulated gateway responding to cellular conditions .

How does the expression of Kch affect E. coli membrane properties?

Overproduction of Kch causes several significant alterations to the E. coli membrane. First, there is a measurable increase in potassium permeability of the cells, confirming the functional activity of the expressed protein . This indicates that recombinant Kch incorporates properly into the membrane and maintains its ion channel functionality.

Beyond permeability changes, Kch expression triggers specific structural modifications to the cytoplasmic membrane. Research has documented a specific increase in cytoplasmic membrane density following Kch production, which correlates with an observed increase in the protein-to-lipid ratio in the membranes . Perhaps most notably, Kch expression alters membrane lipid composition, particularly causing an increase in the cardiolipin-to-phosphatidylglycerol ratio . This change suggests that Kch may have specific cardiolipin requirements for optimal function, potentially reflecting lipid-protein interactions that are essential for channel gating or stability .

What are the optimal expression systems and conditions for recombinant Kch production?

For recombinant Kch expression, E. coli-based expression systems have proven most successful, with studies reporting large-scale overproduction of functional protein . The native E. coli strain serves as an excellent host for homologous expression, avoiding potential issues with membrane protein targeting that might occur in heterologous systems .

The expression typically employs inducible promoter systems, with isopropyl β-D-thiogalactoside (IPTG) commonly used as an inducer . Expression conditions must be carefully optimized since membrane protein overexpression can potentially be toxic to the host cells. Temperature regulation during expression is particularly critical, with lower temperatures (20-25°C) often yielding better results for membrane proteins by slowing production and allowing proper membrane insertion .

Researchers should monitor cell growth before and after induction to ensure that Kch expression doesn't severely impact cell viability. Functional activity can be initially assessed through potassium permeability assays, which should show increased permeability in cells expressing Kch compared to control cells .

What detergents and purification methods are most effective for isolating Kch in a functional state?

Successful solubilization and purification of Kch requires careful selection of detergents. Studies have effectively used multiple detergents with 12-carbon atom chains, including dodecylmaltopyranoside, lauryldimethylamine oxide, and N-laurylsarcosine for membrane extraction and protein solubilization . These detergents maintain the tetrameric structure of Kch, which is essential for its functional properties .

For purification, affinity chromatography using histidine tags has proven effective. The protein can be purified in milligram amounts by imidazole elution from a nickel-chelate column . This approach allows for single-step purification with relatively high yield and purity. Classical purification methods are recommended to prevent protein aggregation, which is a common challenge with membrane proteins .

Post-purification analysis should verify the tetrameric state of the purified protein, typically through size exclusion chromatography or analytical ultracentrifugation . Additionally, CD spectroscopy can confirm the retention of secondary structure, particularly the α-helical content that is characteristic of potassium channels .

How can researchers verify the functional integrity of purified Kch?

Verifying the functional integrity of purified Kch requires multiple complementary approaches. First, structural integrity can be assessed through size exclusion chromatography to confirm the tetrameric assembly, which is the physiologically relevant form of the channel . Circular dichroism spectroscopy provides further confirmation by analyzing secondary structure content, particularly the α-helical regions that are essential for channel function .

For functional verification, reconstitution into lipid bilayers or liposomes is necessary. Researchers can measure potassium flux using fluorescent potassium-sensitive dyes or radioisotope-based assays to confirm channel activity . Electrophysiological techniques such as patch-clamp recordings of reconstituted channels in artificial membranes or lipid bilayers can provide direct evidence of channel functionality, including gating properties and ion selectivity.

A critical consideration is the lipid environment for reconstitution experiments. Given the observed increase in cardiolipin content in membranes expressing Kch, incorporation of cardiolipin in reconstitution mixtures may be essential for optimal channel function . This highlights the importance of membrane composition in maintaining the functional state of purified Kch.

What imaging techniques have been most informative for studying Kch structure?

Electron microscopy (EM) has proven particularly valuable for elucidating Kch structure, with both single-particle reconstruction and electron crystallography yielding significant insights . For membrane-bound Kch, electron crystallography of two-dimensional crystals grown in natural phospholipid environments has provided structural data extending to 6Å resolution . This approach offers the advantage of analyzing the protein in a membrane environment that better preserves native conformation.

The electron crystallographic studies revealed that Kch crystallizes as two symmetrically related overlapping layers with a c12 two-sided plane group arrangement . This structural organization provides important insights into the spatial relationship between the transmembrane domains and the cytosolic RCK domains. Previous studies using electron microscopy with single particle reconstruction had suggested an octameric structure of Kch in solution, composed of two tetrameric full-length proteins interacting through their RCK domains .

For researchers planning structural studies, it's advisable to employ multiple complementary techniques including both solution-based and membrane-integrated approaches, as different methods have revealed different aspects of Kch organization.

How do the RCK domains organize in the Kch channel structure?

This discrepancy between solution-based and membrane-integrated structural studies highlights an important methodological consideration: the structural arrangement of RCK domains may be influenced by experimental conditions, particularly detergent effects versus native lipid environments. Researchers should therefore exercise caution when interpreting RCK domain organization data and consider how preparation methods might influence observed structures.

What is known about the three-dimensional structure of Kch compared to eukaryotic potassium channels?

While high-resolution three-dimensional structures of Kch have not been fully determined, comparative analysis with eukaryotic potassium channels provides valuable insights. Kch shares the fundamental tetrameric architecture characteristic of potassium channels, with each monomer contributing to the central ion-conducting pore . This conservation of quaternary structure underscores the evolutionary relationship between prokaryotic and eukaryotic potassium channels.

For researchers interested in structural comparisons, homology modeling based on related prokaryotic channels with solved structures (such as MthK from Methanothermobacter thermautotrophicus) can provide initial structural models. These models should be validated through experimental approaches such as site-directed mutagenesis targeting predicted functional residues, followed by functional assays.

What is the proposed physiological function of Kch in E. coli?

Based on experimental evidence, Kch is proposed to play a critical role in maintaining membrane potential in E. coli . The ability of the channel to conduct potassium ions across the cytoplasmic membrane would allow it to participate in the regulation of electrical properties of the bacterial cell envelope . This function is particularly relevant considering that potassium is the main intracellular cation in bacteria, as it is in eukaryotic cells.

The specific increase in potassium permeability observed upon Kch overexpression supports this physiological role . Additionally, the alterations in membrane composition, particularly the increased cardiolipin content, may reflect adaptive responses that optimize the electrical properties of the membrane in the presence of increased potassium conductance .

For researchers investigating physiological functions, comparative studies between wild-type and kch deletion mutants under various growth conditions and stress situations would provide valuable insights. The Keio collection, which includes systematic single-gene deletions in E. coli K-12, offers an excellent resource for such comparative analyses .

How does Kch gating respond to voltage changes and other regulatory factors?

While Kch is classified as a voltage-gated potassium channel homologue, detailed characterization of its voltage-dependent gating properties remains limited . By structural homology with eukaryotic channels, the voltage-sensing would likely involve charged residues within the transmembrane segments that respond to changes in membrane potential .

For comprehensive gating studies, researchers should consider combining electrophysiological recordings of reconstituted channels with systematic mutagenesis of predicted voltage-sensing residues and potential ligand-binding sites. Such structure-function analyses would elucidate the complex regulatory mechanisms controlling Kch activity in response to both electrical and chemical signals.

How does Kch expression affect bacterial growth and stress responses?

The effects of Kch expression on bacterial growth and stress responses provide insights into its physiological significance. Overexpression studies have shown that Kch production causes specific alterations in membrane composition and density , which could potentially impact various stress response pathways that rely on membrane integrity.

The systematic gene deletion studies from the Keio collection offer valuable data for understanding gene essentiality and growth effects . While kch was successfully deleted, indicating it is not essential under standard laboratory conditions, the deletion might show phenotypes under specific stress conditions or environmental changes .

For researchers investigating these aspects, comparative growth studies between wild-type, kch-deletion, and kch-overexpression strains under various stress conditions (osmotic stress, pH fluctuations, membrane-targeting antibiotics) would be informative. High-throughput phenotypic profiling using the Biolog system or similar approaches could reveal condition-specific requirements for Kch. Additionally, transcriptomic or proteomic profiling of these strains might identify regulatory networks connected to Kch function.

How can site-directed mutagenesis be applied to study Kch structure-function relationships?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in Kch. Key targets for mutagenesis include the predicted selectivity filter residues, which determine ion specificity, voltage-sensing residues in the transmembrane segments, and ligand-binding sites within the RCK domains .

For selectivity filter studies, researchers should focus on the conserved signature sequence (often TVGYG in potassium channels) that forms the ion selectivity mechanism. Mutations in these residues would be expected to alter ion selectivity or conductance properties . For voltage-sensing, charged residues (particularly arginines and lysines) in the fourth transmembrane segment represent prime targets, as these typically respond to membrane potential changes in voltage-gated channels .

The experimental workflow should include generation of mutants, expression and purification using protocols established for wild-type Kch , followed by functional assays such as reconstitution into liposomes for flux measurements or electrophysiological recordings. Structural integrity of mutants should be verified through techniques like CD spectroscopy to ensure observed functional changes aren't due to protein misfolding .

What approaches can address the discrepancies in observed RCK domain organization?

The discrepancies between solution-based and membrane-integrated structural studies of RCK domain organization require sophisticated approaches to resolve . A multi-technique strategy combining complementary methods would be most informative.

Researchers should consider cryo-electron microscopy of Kch in nanodiscs or other membrane mimetics that better preserve native lipid environments while allowing for high-resolution structural determination. Cross-linking studies with mass spectrometry analysis could identify interaction interfaces between RCK domains under various conditions, helping to determine whether different organizational states exist in different environments or functional states.

Fluorescence resonance energy transfer (FRET) experiments with labeled RCK domains could provide dynamic information about domain organization in real-time, potentially revealing condition-dependent rearrangements. Additionally, hydrogen-deuterium exchange mass spectrometry could identify regions of RCK domains involved in interactions by measuring solvent accessibility changes.

For functional correlation, researchers should design constructs with modified RCK domains that favor specific organizational states, then assess channel activity to determine the functional significance of different RCK arrangements.

How can advanced imaging techniques be integrated with functional studies for comprehensive channel characterization?

Integration of advanced imaging with functional studies offers a powerful approach for comprehensive Kch characterization. High-resolution cryo-electron microscopy of Kch in defined functional states (open, closed, inactivated) could reveal conformational changes associated with channel gating . This would require methods to trap the channel in specific states, such as using non-hydrolyzable ligand analogs or voltage-clamped membrane environments.

Single-molecule fluorescence microscopy of labeled Kch reconstituted into supported lipid bilayers could provide insights into conformational dynamics during gating. This approach allows observation of state transitions in real-time without the averaging effects inherent in bulk measurements. Correlation of these measurements with simultaneous electrophysiological recordings would directly link structural changes to functional states.

For researchers pursuing such integrated approaches, technical considerations include:

  • Designing minimally perturbative labeling strategies that don't interfere with channel function

  • Ensuring appropriate lipid compositions based on the observed membrane alterations in Kch-expressing cells

  • Developing analysis algorithms that can correlate structural and functional data across different timescales

  • Using complementary computational modeling to interpret experimental observations within a mechanistic framework

What challenges are commonly encountered in Kch expression and purification, and how can they be addressed?

Several challenges typically arise during Kch expression and purification. Membrane protein overexpression often leads to toxicity or aggregation within inclusion bodies . To mitigate these issues, researchers should consider using tightly controlled inducible expression systems, lower growth temperatures (20-25°C), and optimization of induction conditions (inducer concentration and induction timing).

Protein aggregation during solubilization and purification represents another common challenge . The choice of detergent is critical – researchers have successfully used dodecylmaltopyranoside, lauryldimethylamine oxide, and N-laurylsarcosine . Screening multiple detergents at various concentrations is advisable for optimizing solubilization conditions. Including stabilizing agents such as glycerol (10-15%) and specific lipids, particularly cardiolipin given its apparent association with Kch function, can improve protein stability during purification .

For purification, the observed changes in membrane composition in Kch-expressing cells suggest that maintaining specific lipids (especially cardiolipin) throughout the purification process may be crucial for preserving native structure and function . Lipid-detergent mixed micelles or addition of lipids to purification buffers may help maintain the lipid microenvironment essential for Kch stability.

What are the key considerations for functional reconstitution of Kch into artificial membrane systems?

Successful functional reconstitution of Kch into artificial membrane systems requires careful attention to several factors. The lipid composition is particularly critical given the observed changes in bacterial membranes upon Kch expression . Including cardiolipin in reconstitution mixtures may be essential for proper channel function, as indicated by the increased cardiolipin-to-phosphatidylglycerol ratio observed in Kch-expressing cells .

The protein-to-lipid ratio requires optimization to avoid excessive protein crowding while ensuring sufficient channel density for functional assays. Typical ratios range from 1:100 to 1:1000 (w/w), but optimal values should be determined empirically for Kch. The reconstitution method also impacts functional outcomes – detergent dialysis, detergent adsorption to Bio-Beads, or dilution methods all have different efficiencies and may affect channel orientation.

For functional verification, researchers should employ multiple complementary approaches. These include ion flux assays using fluorescent indicators or radioisotopes, electrophysiological recordings (patch-clamp or planar lipid bilayer techniques), and structural integrity verification through techniques like freeze-fracture electron microscopy to confirm homogeneous protein distribution within the membrane.

How can researchers distinguish between direct effects of Kch activity and secondary cellular responses in experimental studies?

Distinguishing direct effects of Kch activity from secondary cellular responses requires thoughtful experimental design. One effective approach is to use channel mutants with specific functional alterations. For instance, selectivity filter mutants that alter ion conductance or voltage-sensing mutants that modify gating properties can help identify which cellular effects directly correlate with channel activity .

Temporal studies examining the sequence of events following Kch expression or activation can help establish cause-and-effect relationships. Rapid effects are more likely direct consequences of channel activity, while delayed responses may represent secondary adaptations. Inducible expression systems with tight temporal control facilitate such time-course analyses.

Complementary approaches include:

  • Pharmacological interventions using specific channel blockers (if available for Kch) to acutely inhibit channel function

  • Comparative studies between Kch and other potassium channels with different regulatory properties expressed in the same system

  • Systems biology approaches combining transcriptomics, proteomics, and metabolomics to map the network of cellular responses to Kch activity

  • In vitro reconstitution systems with purified components to verify direct interactions and effects in a defined environment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.