Recombinant Escherichia coli Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

Introduction

ZntB is a zinc transporter protein found in most prokaryotic organisms, playing a crucial role in maintaining intracellular zinc homeostasis in bacteria . It is a transmembrane protein involved in both the import and export of zinc ions (Zn2+^{2+}) . ZntB is of interest because it has been isolated from several pathogenic bacteria, including Escherichia coli, Cupriavidus metallidurans, Salmonella typhimurium, and Enterobacteriaceae, suggesting it may be a critical virulence factor in these pathogens .

Function and Mechanism

ZntB's precise mechanism of action has been a topic of debate, with studies suggesting it functions as both a zinc importer and exporter . Recent structural and functional analyses indicate that ZntB mediates Zn2+^{2+} uptake stimulated by a proton gradient across the membrane, suggesting it functions as a zinc importer . This Zn2+^{2+}/H+^{+} co-transport mechanism distinguishes it from the homologous CorA magnesium channel .

ZntB is part of the CorA superfamily of cation transporters, but unlike CorA, it does not collapse into a highly asymmetrical state upon depletion of divalent cations . The expression of ZntB is downregulated in the presence of high concentrations of Zn2+^{2+}, Cd2+^{2+}, and Cu2+^{2+} .

Role in Zinc Homeostasis

E. coli contains multiple zinc transport systems, including two zinc importers (ZnuABC and ZupT) and two zinc exporters (ZntA and ZitB) . The levels of these transport proteins are regulated at the transcriptional level in a zinc-dependent manner . Two cytosolic transcription factors, ZntR and Zur, are involved in the regulation of zinc response genes .

When external zinc ion concentrations are high, Zur represses the transcription of the znuA and znuBC genes, which shuts off zinc uptake . Conversely, ZntR activates zntA transcription to export excess zinc . Microarray data indicates that zntA transcript is upregulated, while znuC transcript is downregulated in response to changes in zinc concentrations .

ZntB in Salmonella enterica Serovar Typhimurium

In Salmonella enterica serovar Typhimurium, the zntB locus encodes a protein involved in the transmembrane flux of zinc . Mutations in zntB result in hypersensitivity to the cytotoxic effects of zinc, suggesting a role in zinc efflux . Transport assays have shown that zntB mutations reduce the capacity to extrude Zn2+^{2+} without significantly affecting uptake activity, and this deficiency can be complemented by a plasmid encoding a wild-type zntB allele .

Potential as an Antimicrobial Target

Given its role in regulating bacterial zinc concentrations, ZntB could be a target for new antimicrobial drugs . Inhibiting zinc uptake could be a method to combat illness, as zinc is critical for both human and pathogenic bacterial viability .

Tables of Related Research Findings

StudyOrganismKey Findings
Gati et al. (2017) Escherichia coliZntB mediates Zn2+^{2+} uptake stimulated by a proton gradient; functions as a zinc importer.
Abstract in PMC1236622 Escherichia coliAddition of external zinc induces the expression of zinc exporter ZntA and inhibits the expression of zinc importer ZnuC.
NCBI PMC135258 Salmonella entericaZntB is involved in the transmembrane flux of zinc; mutations in zntB result in hypersensitivity to zinc.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zntB; ydaN; b1342; JW1336; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL
Uniprot No.

Target Background

Function
Mediates the efflux of zinc ions.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ZntB and how does it compare to other zinc transporters in E. coli?

ZntB belongs to the CorA MIT (membrane metal ion transporter) family and functions as a zinc importer in Escherichia coli. It differs significantly from the other major zinc transporters found in E. coli: ZnuACB and ZupT. While ZnuACB belongs to the cluster C9 family of ATP-binding cassette (ABC) transporters and uses ATP hydrolysis for transport, ZntB relies on a proton gradient as its driving force . ZupT, meanwhile, belongs to the ZIP (ZRT/IRT-like protein) family of transporters and is thought to require a chemo-osmotic gradient for function .

What structural features characterize ZntB?

The full-length structure of ZntB reveals important insights into its transport mechanism. Unlike CorA Mg²⁺ channels (which belong to the same MIT family), ZntB does not collapse into a highly asymmetrical state upon depletion of divalent cations . The protein maintains a symmetrical scaffold that undergoes specific movements to create a pathway for zinc transport.

The cytoplasmic domain of full-length E. coli ZntB (EcZntB) exhibits a strong positive electrostatic surface potential, which contrasts with the negative potential observed in the isolated domain of Salmonella typhimurium ZntB (StZntB) . This difference in surface charge distribution is likely critical for the directional transport of zinc ions across the membrane.

What is the substrate specificity of ZntB?

ZntB primarily transports zinc but also demonstrates affinity for other divalent cations. Transport assays using the fluorescent dye fluozin-1 have shown that ZntB can transport Ni²⁺ and Cd²⁺ at levels comparable to Zn²⁺, but transport of Co²⁺ was not detected in these assays . This may be due to lower sensitivity of the detection dye to cobalt rather than an inability of ZntB to transport this ion.

Isothermal titration calorimetry (ITC) experiments have provided quantitative measurements of binding, with dissociation constants (Kᴅ) of approximately 7.5 μM for zinc, indicating a transporter mechanism rather than a channel-like function .

What is the molecular mechanism of zinc transport by ZntB?

The transport mechanism of ZntB involves conformational changes in its symmetrical structure to create a pathway for zinc ions. Unlike the well-characterized CorA channels, ZntB functions as an importer rather than a channel, utilizing a proton gradient to drive the uptake of zinc into the cell .

Key to this mechanism is the electrostatic surface of the transport pathway. Comparison between the full-length EcZntB structure (obtained in the absence of Zn²⁺) and the soluble domain of StZntB (crystallized in the presence of Zn²⁺) reveals dramatic differences in surface potentials . This charge inversion between conformational states is potentially facilitated by helical rotation of TM1, which contains conserved basic and acidic residues on adjacent faces of the helix.

The internal pore between these two forms differs in shape, likely representing different conformational states in the transport cycle. This structural rearrangement appears essential for the directional movement of zinc ions across the membrane barrier .

How do the conformational states of ZntB contribute to its transport function?

ZntB undergoes specific conformational changes during the transport cycle that facilitate zinc movement. The comparison between full-length EcZntB and the soluble domain of StZntB provides insights into these movements .

The most notable difference is in the electrostatic surface potential of the cytoplasmic domain, which shifts from strongly positive in EcZntB to negative in StZntB . This charge inversion may be critical for attracting zinc ions in one conformation and releasing them in another.

Additionally, the shape of the internal pore differs between the two forms, suggesting distinct conformational states that allow for controlled ion passage. Unlike CorA channels, which exhibit dramatic asymmetry upon divalent cation depletion, ZntB maintains a more symmetrical structure throughout its transport cycle .

How does ZntB's structure compare to other CorA family members?

Despite belonging to the same MIT family as CorA Mg²⁺ channels, ZntB exhibits distinct structural and functional characteristics. The most significant difference is that ZntB does not collapse into a highly asymmetrical state when divalent cations are depleted, as observed with CorA .

The electrostatic properties of ZntB also differ from those of CorA channels. While both proteins contain a central pore for ion passage, the charge distribution and conformational changes during transport appear to be distinct, reflecting their different transport directions and ion selectivities .

These structural differences provide important insights into the evolution of transport mechanisms within the MIT family and highlight the specialized adaptations that enable ZntB to function as a zinc importer rather than a channel.

What techniques are effective for studying ZntB transport activity?

Several complementary approaches have proven effective for measuring ZntB transport activity:

  • Fluorescent dye assays: The fluorescent dye fluozin-1 can be used to detect zinc transport by ZntB reconstituted into liposomes. This approach has also been applied to assess transport of other divalent cations like Ni²⁺ and Cd²⁺ .

  • Radioisotope uptake assays: ⁶⁵Zn²⁺ uptake assays provide quantitative measurements of transport rates and can be used to compare different mutant versions of the protein. This approach has been effectively used to assess the relative contributions of different zinc transporters in E. coli .

  • Growth assays in zinc-limited media: Complementation of growth defects in zinc transporter mutants provides a functional readout of ZntB activity. Strains lacking multiple zinc transporters (e.g., Δznu ΔzupT) show reduced growth in minimal medium, which can be rescued by expression of functional ZntB .

Table 1. Comparison of methods for measuring ZntB transport activity

MethodAdvantagesLimitationsApplications
Fluozin-1 assayReal-time measurements, suitable for reconstituted systemsVariable sensitivity to different metal ionsIn vitro transport kinetics
⁶⁵Zn²⁺ uptakeDirect measurement of zinc transport, high specificityRequires radioisotope handlingQuantitative comparison of transport rates
Growth complementationDemonstrates physiological relevanceIndirect measure of transport activityAssessment of in vivo function

How can ZntB be effectively expressed and purified for structural studies?

For structural studies of ZntB, single-particle cryo-electron microscopy has proven effective. The published protocol indicates purifying ZntB to a final concentration of ~10 mg/ml before applying to glow-discharged holey carbon grids .

The preparation involves:

  • Expression of the recombinant protein in an appropriate E. coli strain

  • Purification using affinity chromatography and size exclusion techniques

  • Concentration of the purified sample to approximately 10 mg/ml

  • Application of 3 μl aliquots to freshly glow-discharged holey carbon grids

  • Blotting for 4-5 seconds using a FEI Vitrobot Mark IV

  • Plunge freezing in liquid ethane at approximately 100K

  • Transfer to a high-powered electron microscope (e.g., Titan Krios 300 keV)

  • Image collection using a direct-electron detector

This approach has successfully yielded high-resolution structural data for ZntB, enabling the visualization of important structural features that inform our understanding of its transport mechanism.

What reconstitution systems are appropriate for functional studies of ZntB?

For functional characterization of ZntB transport activity, reconstitution into liposomes has been successfully employed. This system allows for the controlled investigation of transport properties and substrate specificity.

The reconstituted ZntB-liposome system has been used with the fluozin-1 dye to assess transport of various divalent cations, including Zn²⁺, Ni²⁺, and Cd²⁺ . This approach provides a clean system for measuring transport kinetics without the confounding factors present in whole cells.

Alternative approaches include the complementation of zinc transporter-deficient E. coli strains (e.g., Δznu ΔzupT) with plasmids encoding ZntB . This allows for assessment of in vivo transport function and can be combined with radioisotope uptake assays to quantify transport activity.

How can binding affinity be measured for ZntB and its substrates?

Isothermal titration calorimetry (ITC) has been effectively used to measure the binding affinity between ZntB and its substrates. This technique provides thermodynamic parameters of binding, including the dissociation constant (Kᴅ).

For ZntB, ITC experiments have revealed a Kᴅ of approximately 7.5 μM for zinc binding, which is consistent with a transporter mechanism rather than a channel-like function . This technique can also be applied to investigate binding of other potential substrate ions.

Complementary approaches include competitive binding assays and fluorescence-based binding measurements, which can provide additional insights into the substrate specificity and binding properties of ZntB.

How does ZntB function compare to ZnuACB and ZupT in E. coli?

Studies comparing the three major zinc transporters in E. coli (ZnuACB, ZupT, and ZntB) have revealed important functional distinctions:

  • Transport mechanism: ZnuACB uses ATP hydrolysis for active transport, ZupT is thought to require a chemo-osmotic gradient, and ZntB functions as a proton-driven zinc importer .

  • Impact on growth: In uropathogenic E. coli, loss of ZnuACB has the most pronounced effect on growth in zinc-limited conditions. The Δznu mutant showed an intermediate decrease in ⁶⁵Zn²⁺ uptake and growth in minimal medium, whereas the ΔzupT mutant grew as well as the wild type strain .

  • Zinc uptake efficiency: ZnuACB appears to be the predominant zinc transporter in UPEC strain CFT073. Loss of the Znu system resulted in the greatest decrease in ⁶⁵Zn²⁺ accumulation, while loss of ZupT had a less marked effect .

  • Substrate specificity: While ZnuACB functions primarily as a zinc-specific transporter, ZupT has been shown to mediate the uptake of Mn²⁺ and Fe²⁺ in addition to Zn²⁺ . ZntB demonstrates transport activity for Zn²⁺, Ni²⁺, and Cd²⁺ .

These functional differences reflect the specialized roles of each transporter in maintaining zinc homeostasis under different environmental conditions.

What is the physiological significance of having multiple zinc transport systems?

The presence of multiple zinc transport systems in E. coli (ZnuACB, ZupT, and ZntB) reflects the importance of precise zinc homeostasis for bacterial physiology and the need for adaptability to varying environmental conditions.

Each transporter appears to have specialized roles:

  • ZnuACB: The predominant zinc transporter, with the highest affinity for zinc and the greatest impact on growth in zinc-limited conditions .

  • ZupT: A lower-affinity transporter with broader substrate specificity, potentially providing a backup system for zinc acquisition and contributing to the transport of other divalent cations .

  • ZntB: A proton-driven zinc importer with distinct structural and functional properties from the other transporters, possibly optimized for specific environmental conditions .

This redundancy ensures that E. coli can maintain appropriate zinc levels across diverse environmental niches, including during infection of host tissues where zinc availability may be limited as part of nutritional immunity.

What are the key unanswered questions about ZntB function?

Despite significant advances in our understanding of ZntB structure and function, several important questions remain:

  • Detailed transport mechanism: While ZntB has been characterized as a proton-driven zinc importer, the precise coupling mechanism between proton and zinc transport remains to be fully elucidated.

  • Regulatory mechanisms: How ZntB expression and activity are regulated in response to zinc availability and other environmental signals is not fully understood.

  • Role in pathogenesis: Unlike ZnuACB, which has been implicated in virulence of several bacterial pathogens including Salmonella, Brucella, and Haemophilus, the contribution of ZntB to bacterial pathogenesis requires further investigation .

  • Structural dynamics: Additional structures of ZntB in different conformational states will be essential to describe its transport mechanism in greater detail .

Addressing these questions will require a combination of structural, biochemical, and genetic approaches, and will provide important insights into bacterial metal homeostasis and potential targets for antimicrobial development.

What methodological advances would enhance ZntB research?

Several methodological advances could significantly enhance our understanding of ZntB function:

  • Time-resolved structural studies: Techniques that capture transient conformational states during the transport cycle would provide valuable insights into the mechanism of zinc transport.

  • Single-molecule approaches: Methods such as single-molecule FRET could reveal the dynamics of ZntB conformational changes during transport.

  • Advanced reconstitution systems: Development of more sophisticated membrane mimetics that better recapitulate the native membrane environment would improve functional studies.

  • In vivo imaging: Techniques for visualizing zinc transport in living bacteria would provide important context for understanding the physiological roles of different transporters.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.