Recombinant Escherichia coli Zinc transporter zitB (zitB)

Shipped with Ice Packs
In Stock

Description

Functional Mechanisms

Recombinant ZitB functions as a Zn²⁺/H⁺ antiporter with the following kinetic properties:

  • Substrate Specificity:

    • Primary substrate: Zn²⁺ (Michaelis-Menten constant, Km=104.9±5.4μMK_m = 104.9 \pm 5.4 \, \mu M) .

    • Secondary substrates: Cd²⁺ (Km=90.1±3.7μMK_m = 90.1 \pm 3.7 \, \mu M), Ni²⁺, and Cu²⁺ .

  • Transport Mechanism:

    • Obligatory 1:1 exchange of Zn²⁺ or Cd²⁺ for H⁺ .

    • Electrogenic transport driven by proton gradients and membrane potential .

  • Regulation:

    • Induced by Zn²⁺ at concentrations >50 μM .

    • Co-regulated with ZntA (a P-type ATPase) under zinc stress .

Research Applications

Recombinant ZitB is utilized in diverse experimental models:

  • Metal Transport Studies:

    • Stopped-flow fluorescence assays in proteoliposomes to measure Zn²⁺/Cd²⁺ fluxes .

    • Solid-state NMR to map metal-binding sites in native membranes .

  • Genetic and Phenotypic Analysis:

    • Double knockout strains (ΔzitB ΔzntA) exhibit heightened zinc sensitivity .

    • Overexpression confers resistance to Zn²⁺ (up to 5 mM) .

Comparative Roles in Zinc Homeostasis

FeatureZitB (CDF Family)ZntA (P-type ATPase)
SubstrateZn²⁺, Cd²⁺, Ni²⁺, Cu²⁺Zn²⁺, Cd²⁺, Pb²⁺
Transport TypeAntiporter (H⁺-coupled)ATP-driven pump
Induction Threshold~50 μM Zn²⁺~100 nM Zn²⁺
Knockout PhenotypeMild sensitivitySevere sensitivity

Key Research Findings

  • Mutational Analysis: Substitutions at H53, H159, D163, or D186 abolish transport activity, confirming their role in metal coordination .

  • Substrate Competition: Ni²⁺ and Cu²⁺ inhibit Zn²⁺ binding in vitro, suggesting a broad substrate profile .

  • Physiological Role: Acts as a first-line defense against zinc influx, while ZntA handles higher zinc concentrations .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
zitB; ybgR; b0752; JW0735; Zinc transporter ZitB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
zitB
Target Protein Sequence
MAHSHSHTSSHLPEDNNARRLLYAFGVTAGFMLVEVVGGFLSGSLALLADAGHMLTDTAA LLFALLAVQFSRRPPTIRHTFGWLRLTTLAAFVNAIALVVITILIVWEAIERFRTPRPVE GGMMMAIAVAGLLANILSFWLLHHGSEEKNLNVRAAALHVLGDLLGSVGAIIAALIIIWT GWTPADPILSILVSLLVLRSAWRLLKDSVNELLEGAPVSLDIAELKRRMCREIPEVRNVH HVHVWMVGEKPVMTLHVQVIPPHDHDALLDQIQHYLMDHYQIEHATIQMEYQPCHGPDCH LNEGVSGHSHHHH
Uniprot No.

Target Background

Function
ZitB plays a role in zinc efflux across the cytoplasmic membrane, reducing zinc accumulation in the cytoplasm and enhancing bacterial resistance to zinc. It may contribute to zinc homeostasis at low concentrations, while ZntA is essential for growth at higher, more toxic concentrations.
Gene References Into Functions
  1. Charged or polar amino acyl residues within or adjacent to membrane-spanning regions of the protein were crucial for the full function of the proteins, namely cation export or proton import PMID: 15516561
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ZitB and what is its role in zinc homeostasis in E. coli?

ZitB (formerly YbgR) is a zinc transporter belonging to the cation diffusion facilitator (CDF) family in Escherichia coli. It functions primarily as a zinc efflux protein that helps maintain zinc homeostasis by exporting excess zinc from bacterial cells. ZitB is specifically induced by zinc and plays a crucial role in zinc resistance. When expressed on a plasmid in zntA-disrupted E. coli cells, ZitB renders these cells more resistant to zinc, with reduced accumulation of 65Zn, demonstrating its zinc efflux capability .

ZitB contributes to zinc homeostasis as a constitutive, first-line defense against toxic zinc influx, while another zinc exporter, ZntA, is up-regulated to efficiently lower free zinc concentration when exposed to higher zinc levels . This division of labor is essential because while zinc is necessary for many cellular functions, excess zinc is toxic, requiring sophisticated homeostatic mechanisms to control intracellular zinc levels .

Experimental evidence shows that in the ΔzitB strain, free zinc concentration rises more rapidly after zinc shock compared to wild-type cells, while a prolonged accumulation of free zinc is observed in the ΔzntA strain . This confirms that ZitB provides immediate protection against sudden zinc influx.

How does ZitB differ from other zinc transporters in E. coli?

ZitB is part of a complex zinc homeostasis system in E. coli that includes multiple transporters with distinct properties:

FeatureZitBZntAYiiP
FamilyCation Diffusion FacilitatorP-type ATPaseCation Diffusion Facilitator
Energy sourceProton gradient (H+/Zn2+ antiporter)ATP hydrolysisProton gradient
Transport kineticsKm of ~105 μM for zincApparent Km of 9 μMNot well characterized
Metal specificitySelective for zincTransports zinc and cadmiumFunction remains unknown
RegulationZinc-inducibleRegulated by ZntR, zinc-inducibleZinc-inducible
Role in homeostasisLow zinc concentrationsHigher zinc concentrationsUnknown function

ZitB functions as an antiporter catalyzing the exchange of Zn2+ for H+ with a stoichiometry of 1:1 . In contrast, ZntA is an ATP-driven transporter. While a strain disrupted only in zitB does not exhibit decreased zinc tolerance (likely because ZntA compensates), double disruption of zitB and zntA renders E. coli cells more zinc sensitive than a single disruption in zntA alone . This demonstrates the complementary roles these transporters play in maintaining zinc homeostasis.

Unlike ZitB, which specifically contributes to zinc resistance, YiiP (another CDF family member) does not confer additional zinc resistance when overexpressed, and disruption of yiiP does not alter zinc resistance, indicating its physiological role remains unclear .

How is the expression of ZitB regulated in response to zinc?

The expression of ZitB is specifically induced by zinc in a concentration-dependent manner. Recent research has revealed a sophisticated regulatory mechanism involving the zinc uptake regulator (Zur) protein:

Zinc-dependent gene regulation by Zur occurs in two distinct phases:

  • At sub-femtomolar zinc concentrations (phase I), dimeric Zur binds to the Zur-box motif immediately upstream of the zitB promoter, resulting in low zitB expression. Simultaneously, Zur represses genes for zinc uptake .

  • At micromolar zinc concentrations (phase II), oligomeric Zur binding with footprint expansion upward from the Zur box results in high zitB induction .

This dual regulatory mechanism represents an elegant solution for controlling both zinc import and export through a single metalloregulator across a wide range of zinc concentrations. This finding is significant because it reveals a mode of zinc-dependent gene activation that uses a single regulator to control genes for both uptake and export .

In E. coli, β-galactosidase activity measurements in a zitB-lacZ transcriptional fusion strain have shown that ZitB expression increases in response to zinc exposure . This zinc-responsive expression ensures that ZitB is available when needed to maintain zinc homeostasis.

What experimental approaches are used to study ZitB function in zinc transport?

Multiple experimental approaches have been developed to study ZitB's function in zinc transport:

Genetic Approaches

  • Gene Knockout Studies: Creating ΔzitB single mutants and ΔzitB/ΔzntA double mutants to assess zinc sensitivity

  • Complementation Experiments: Expressing ZitB from plasmids in zinc-sensitive strains to restore zinc resistance

  • Reporter Gene Fusions: Using zitB-lacZ fusions to monitor zitB expression under various conditions

Biochemical Approaches

  • Radioactive Zinc (65Zn) Accumulation Assays: Comparing levels of cell-associated zinc ions in E. coli strains with and without expressed ZitB

  • Transport Kinetics Measurements: Using stopped-flow techniques to determine kinetic parameters (Km, Vmax) of ZitB-mediated transport

  • Protein Purification and Reconstitution: Isolating ZitB and reconstituting it in artificial membrane systems to study its transport properties in isolation

Structural Studies

  • Protein Expression and Purification: Overexpressing His-tagged ZitB using expression vectors (e.g., pET15b) in E. coli BL21 cells

  • Crystallization Trials: Growing ZitB crystals using precipitants like PEG 1K at 20°C

  • Structural Characterization: Confirming protein identity through mass spectrometry, showing the expected molecular weight of 35.2kDa

For example, one study demonstrated that when levels of cell-associated zinc ions in E. coli strain GG48 (ΔzitB::Cm zntA::Km) with and without expressed ZitB were compared, resistant cells accumulated significantly less zinc than control cells, providing direct evidence of ZitB-mediated zinc efflux .

How can recombinant ZitB be effectively expressed and purified?

The successful expression and purification of recombinant ZitB involves several critical steps:

Expression System

  • Vector Selection: pET15b expression vector has been successfully used for ZitB expression with a His-tag for purification

  • Host Selection: E. coli BL21 cells are commonly used as they lack certain proteases that could degrade the recombinant protein

  • Induction Method: Protein expression can be induced using IPTG for T7 promoter-based systems or anhydrotetracycline for tet-inducible systems

Purification Protocol

  • Membrane Preparation: Preparation of ZitB-containing membrane vesicles from expressing cells

  • Detergent Extraction: Solubilization of membrane proteins using appropriate detergents

  • Affinity Chromatography: Purification using Ni-NTA metal affinity chromatography for His-tagged proteins

  • Size Exclusion Chromatography: Further purification to remove aggregates and achieve homogeneous protein preparations

  • Quality Control: Confirmation of purified ZitB by mass spectrometry (expected MW: 35.2kDa)

Optimization Considerations

  • Temperature: Lower expression temperatures (e.g., 20-30°C) may increase the proportion of correctly folded membrane protein

  • Detergent Selection: Screening multiple detergents is critical as membrane proteins require specific detergents for stability

  • Additives: Including stabilizing agents such as glycerol or specific lipids can improve protein stability

  • Purification Conditions: pH, salt concentration, and buffer composition should be optimized to maintain protein integrity

Using this approach, researchers have successfully purified ZitB for crystallization studies, achieving micro-crystals in 25% PEG 1K at 20°C . This purification process is critical for subsequent structural and functional characterization of ZitB.

How can experimental designs be optimized to study ZitB's role in zinc detoxification?

A well-designed experimental approach to study ZitB's role in zinc detoxification should incorporate multiple complementary methods:

Experimental Design Template

Title: Investigating the Role of ZitB in Zinc Detoxification in Escherichia coli

Hypothesis: ZitB functions as a primary zinc efflux system that protects E. coli from zinc toxicity at moderate zinc concentrations, while ZntA becomes essential at higher zinc concentrations.

Independent Variable: Zinc chloride (ZnCl₂) concentration in growth media (0, 0.1, 0.25, 0.5, 1.0 mM)

Dependent Variables:

  • Growth rate (measured by OD600 over time)

  • Intracellular zinc content (quantified by ICP-MS or 65Zn uptake)

  • zitB gene expression (assessed by RT-qPCR or reporter assays)

Number of trials: 3 biological replicates with 3 technical replicates each

Control Group: Wild-type E. coli K-12 strain

Experimental Groups:

  • ΔzitB (zitB knockout strain)

  • ΔzntA (zntA knockout strain)

  • ΔzitB/ΔzntA (double knockout strain)

  • Wild-type with ZitB overexpression

Controlled Variables:

  • Temperature (37°C)

  • Media composition (LB or defined minimal media)

  • Aeration conditions (200 rpm shaking)

  • Initial cell density (OD600 = 0.05)

  • Growth phase for sampling (mid-logarithmic phase)

Data Collection Template

ZnCl₂ Concentration (mM)StrainGrowth Rate (OD600/hour) Trial 1Trial 2Trial 3AverageStd DevIntracellular Zn (μg/g dry weight)zitB Expression (fold change)
0Wild-type
0ΔzitB
0ΔzntA
0ΔzitB/ΔzntA
0.25Wild-type
0.25ΔzitB
0.25ΔzntA
0.25ΔzitB/ΔzntA

Additional zinc concentrations would follow the same format.

Supporting Methodologies

Growth Inhibition Assays:

  • Measure optical density (OD600) over time in media containing various zinc concentrations

  • Determine minimum inhibitory concentration (MIC) for each strain

  • Previous studies have shown substantial growth attenuation for ΔzntA mutants and total growth restriction for ΔzntA/ΔzitB double mutants in LB supplemented with 0.25 mM ZnCl₂

Transport Assays:

  • Monitor 65Zn accumulation in different strains over time

  • Determine zinc efflux rates following loading with 65Zn

  • Evidence suggests ZitB-expressing cells accumulate significantly less zinc than control cells

Expression Analysis:

  • Use quantitative PCR to measure zitB and zntA expression levels under varying zinc conditions

  • Employ reporter gene constructs (e.g., zitB-lacZ) to visualize expression patterns

  • Past studies have shown that both zitB and yiiP expression are inducible by zinc in a concentration-dependent manner

This experimental design enables comprehensive analysis of ZitB's contribution to zinc detoxification while controlling for variables that might affect results7.

What challenges exist in structural studies of ZitB and how can they be overcome?

Structural studies of membrane proteins like ZitB present several significant challenges:

Challenges in Membrane Protein Crystallization

  • Protein Extraction: Removing membrane proteins from their native lipid environment while maintaining structure and function is difficult

  • Protein Stability: Membrane proteins often become unstable when solubilized in detergents

  • Homogeneity: Achieving monodisperse protein preparations necessary for crystallization

  • Crystal Packing: Limited polar surfaces for crystal contacts in membrane proteins

  • Crystal Growth: Obtaining crystals of sufficient size and quality for X-ray diffraction

Approaches to Overcome These Challenges

  • Optimized Expression Systems:

    • Use specialized expression vectors (e.g., pET15b) that provide tight regulation of protein expression

    • Express in strains designed for membrane protein production

    • Employ slow induction at lower temperatures to improve folding

  • Purification Strategies:

    • Screen multiple detergents to identify those that maintain protein stability

    • Implement multi-step purification (e.g., Ni-NTA affinity followed by size exclusion chromatography)

    • Include stabilizing additives in purification buffers

  • Crystallization Techniques:

    • Screen various precipitation agents (successful micro-crystals of ZitB were grown in 25% PEG 1K)

    • Explore lipidic cubic phase crystallization for membrane proteins

    • Consider protein engineering to improve crystallizability (e.g., removal of flexible regions)

    • Use of antibody fragments or nanobodies to provide additional crystal contacts

  • Alternative Structural Methods:

    • Cryo-electron microscopy (cryo-EM) for structure determination without crystals

    • Nuclear magnetic resonance (NMR) for structural analysis of smaller membrane proteins

    • Computational approaches to predict structure based on homology and experimental constraints

For ZitB specifically, initial crystallization trials conducted at 20°C using low molecular weight PEGs as precipitants have shown promise, with micro-crystals grown in 25% PEG 1K, while only amorphous precipitations were observed in PEG 400 and 600 . This provides a foundation for further optimization to obtain diffraction-quality crystals.

How do zinc-responsive regulatory systems control ZitB expression?

The regulation of ZitB expression involves sophisticated zinc-sensing mechanisms:

Zur-Mediated Regulation

Recent research has revealed that the zinc uptake regulator (Zur) protein controls zitB expression through a biphasic mechanism:

  • Phase I (Low Zinc): At sub-femtomolar zinc concentrations, dimeric Zur binds to the Zur-box motif immediately upstream of the zitB promoter, resulting in low zitB expression. Simultaneously, Zur represses genes for zinc uptake .

  • Phase II (High Zinc): At micromolar zinc concentrations, oligomeric Zur binding expands upward from the Zur box, resulting in high zitB induction .

This represents a novel regulatory paradigm where a single metalloregulator controls both zinc import and export genes across a wide range of zinc concentrations.

ZntR-ZntA System Interaction

While ZitB is regulated by Zur, the other major zinc exporter ZntA is regulated by ZntR:

  • ZntR is a MerR-like transcription factor activated by zinc

  • Apo-ZntR dimer weakly represses zntA transcription

  • Zinc-bound ZntR activates transcription by inducing DNA unwinding

  • ZntR has an apparent femtomolar affinity for zinc binding and activation

The differential regulation of ZitB and ZntA allows E. coli to respond appropriately to varying levels of zinc stress:

  • ZitB functions as a constitutive, first-line defense against toxic zinc influx

  • ZntA is up-regulated to efficiently lower free zinc concentration when zinc levels become dangerous

Experimental Methods to Study Regulation

Several approaches have been employed to study the regulation of zitB expression:

  • Reporter Gene Assays: β-galactosidase activity in zitB-lacZ transcriptional fusion strains

  • DNA Binding Studies: Electrophoretic mobility shift assays and DNA footprinting to characterize Zur binding

  • Expression Analysis: RT-qPCR to quantify zitB mRNA levels under various zinc conditions

  • Proteomics: Mass spectrometry to identify changes in protein expression profiles

Understanding these regulatory mechanisms provides insights into how bacteria maintain zinc homeostasis and may reveal targets for antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.