Recombinant Escherichia coli Zinc transporter ZupT (zupT)

Shipped with Ice Packs
In Stock

Description

Overview of ZupT and Its Recombinant Form

ZupT (formerly ygiE) is a cytoplasmic membrane protein encoded by the zupT gene in E. coli. It facilitates the uptake of zinc (Zn²⁺) and other divalent cations (e.g., Fe²⁺, Mn²⁺, Co²⁺) via a chemiosmotic gradient-dependent mechanism . Recombinant ZupT is typically produced as a full-length protein (1–257 amino acids) and is often used in structural studies or functional assays to explore its transport kinetics and metal specificity .

CharacteristicDetailSource
FamilyZIP (Zinc-regulated, Iron-regulated Transporter-like) family
Substrate SpecificityZn²⁺, Fe²⁺, Mn²⁺, Co²⁺
Expression SystemsE. coli, yeast, baculovirus, mammalian cells
RegulationNot directly regulated by zinc; functionally linked to oxidative stress

Functional Mechanism

ZupT operates via a proton motive force-driven mechanism, enabling the uptake of Zn²⁺ and other divalent cations. Key functional studies include:

  • Zn²⁺ Uptake: ZupT compensates for Zn²⁺ deficiency when primary transporters (e.g., ZnuACB) are disrupted .

  • Metal Specificity: Transport of Fe²⁺ and Co²⁺ is observed in radiolabeled assays, though Zn²⁺ affinity is higher .

  • Oxidative Stress Resistance: ZupT contributes to intracellular Zn²⁺ levels, which protect against reactive oxygen species (ROS) .

Zinc Homeostasis

ZupT is essential for growth under zinc-limited conditions. Deletion of zupT in E. coli strains lacking ZnuACB results in severe Zn²⁺ deficiency, as shown by:

  • Growth Defects: ΔzupT mutants exhibit impaired growth in minimal media unless Zn²⁺ is supplemented .

  • ICP-MS Analysis: Intracellular Zn²⁺ levels in ΔzupT strains are significantly reduced compared to wild-type .

Metal Specificity and Toxicity

ZupT’s broad substrate specificity poses risks of metal toxicity:

  • Co²⁺ and Mn²⁺ Sensitivity: Overexpression of ZupT renders E. coli hypersensitive to Co²⁺ and Mn²⁺, indicating competitive uptake .

  • Fe²⁺ Transport: ZupT facilitates Fe²⁺ uptake in strains lacking iron-specific transporters (e.g., FeoABC) .

Role in Pathogenicity

In uropathogenic E. coli (UPEC), ZupT contributes to virulence:

  • Urinary Tract Infection (UTI) Models: ΔzupT mutants show reduced colonization in murine kidneys and bladders, linked to impaired Zn²⁺ acquisition .

  • Oxidative Stress and Motility: ZupT-deficient strains exhibit decreased resistance to H₂O₂ and reduced motility, critical for host invasion .

Biotechnological Tools

Recombinant ZupT is used in:

  • Structural Biology: Studying ZIP family transporter mechanisms .

  • Metal Toxicity Assays: Screening for heavy metal uptake and detoxification strategies .

Clinical Relevance

  • Antibiotic Resistance: Zn²⁺ homeostasis via ZupT may influence antibiotic efficacy, particularly in Zn²⁺-deprived environments .

  • Targeted Therapies: Inhibiting ZupT could disrupt bacterial Zn²⁺ acquisition, enhancing host defense mechanisms .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly specify them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on your purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
zupT; ECDH10B_3214; Zinc transporter ZupT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Escherichia coli (strain K12 / DH10B)
Target Names
zupT
Target Protein Sequence
MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFSLGFAAGIMLLISLMEMLPAALAAE GMSPVLGYGMFIFGLLGYFGLDRMLPHAHPQDLMQKSVQPLPKSIKRTAILLTLGISLHN FPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGLA EILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG MSVMGFSLVLLQTAGIG
Uniprot No.

Target Background

Function
Recombinant Escherichia coli Zinc transporter ZupT (zupT) mediates zinc uptake and may also transport other divalent cations.
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family, ZupT subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the ZupT transporter and what is its function in E. coli?

ZupT (formerly known as ygiE) is a cytoplasmic membrane protein in Escherichia coli that functions as a divalent metal cation transporter with broad substrate specificity. It is the first characterized bacterial member of the ZIP (ZRT, IRT-like protein) family of transporters, which are widespread in eukaryotes. ZupT's primary role is to facilitate the uptake of zinc, but it also mediates the transport of other divalent metal ions including iron (Fe²⁺), cobalt (Co²⁺), and potentially manganese (Mn²⁺) . Unlike many metal transporters, ZupT appears to be constitutively expressed at low levels and is not regulated by metal availability, suggesting it serves as a housekeeping transporter for maintaining basal levels of essential metals in the bacterial cell .

How does ZupT differ from other zinc transporters in E. coli?

E. coli possesses two primary zinc uptake systems: ZupT and ZnuACB. While both transport zinc, they differ significantly in structure, mechanism, and regulation. ZnuACB belongs to the ATP-binding cassette (ABC) family of transporters and consists of three components: ZnuA (periplasmic binding protein), ZnuB (membrane permease), and ZnuC (ATPase) . ZnuACB requires ATP hydrolysis to transport zinc across the membrane and is strongly regulated by zinc availability through the Zur repressor. In contrast, ZupT is a single polypeptide transporter that likely functions using a chemiosmotic transmembrane gradient rather than ATP hydrolysis . Additionally, ZnuACB is the predominant zinc transporter under zinc-limited conditions, whereas ZupT contributes to zinc uptake at a lower level but can transport multiple divalent metals . Strains with mutations in both systems show more severe growth defects in zinc-limited conditions than single mutants, indicating complementary but non-redundant functions .

What experimental approaches are used to measure ZupT-mediated metal transport?

Several experimental approaches have been employed to measure ZupT-mediated metal transport:

  • Radioisotope uptake assays: Using radioisotopes such as ⁶⁵Zn²⁺, ⁵⁵Fe²⁺, or ⁵⁷Co²⁺ to directly measure metal uptake in intact cells expressing ZupT compared to control cells .

  • Growth assays in metal-limited conditions: Comparing growth of wild-type, ΔzupT mutants, and complemented strains in media containing metal chelators like EDTA . Strains lacking functional ZupT show increased sensitivity to metal limitation.

  • Competitive metal titrations: Using purified ZupT protein to determine binding affinities for different metal ions and stoichiometry of binding .

  • Metal sensitivity assays: Examining growth in the presence of elevated metal concentrations, as ZupT overexpression can increase sensitivity to certain metals by facilitating their uptake .

  • Site-directed mutagenesis: Creating specific mutations in residues thought to be involved in metal binding or transport, followed by functional assays to determine their importance .

These methodologies, particularly when used in combination, provide complementary information about ZupT's metal transport capabilities and mechanism.

What is known about the structural basis of metal selectivity in ZupT?

The structural basis of metal selectivity in ZupT involves a binuclear metal transport site, which is relatively uncommon for metal transporters. Homology modeling based on a ZIP transporter from Bordetella bronchiseptica (32% identity with ZupT) has revealed key structural features . In the ZupT model, two metal binding sites have been identified. The metal ions in these sites are separated by approximately 4.2 Å, with site 1 (the primary transport site) coordinated by His 148, Glu 152, and bidentate Glu 123, while site 2 (the secondary site) is coordinated by Asn 120, Asn 149, and Glu 181 .

Experimental evidence from competitive metal titrations and site-directed mutagenesis studies reveals differential binding patterns: zinc, the primary substrate, binds one equivalent at physiological concentrations and exclusively to site 1, whereas iron binds two equivalents - one to site 1 and another to site 2 . This structural arrangement helps explain ZupT's broad substrate specificity while maintaining preference for zinc.

How do ZupT and ZnuACB systems interact or compensate for each other in E. coli?

The interaction between ZupT and ZnuACB represents a sophisticated dual-system approach to zinc homeostasis in E. coli. Studies with single and double mutants have provided significant insights into their compensatory mechanisms:

This relationship illustrates how E. coli employs complementary systems with different regulatory mechanisms, affinities, and specificities to maintain zinc homeostasis across varying environmental conditions.

What methodological challenges exist in studying ZupT function and how can they be addressed?

Studying ZupT function presents several methodological challenges that researchers must navigate:

  • Protein expression and purification difficulties: Like many membrane proteins, ZupT can be challenging to express and purify in sufficient quantities for biochemical and structural studies. This creates a bottleneck in mechanistic investigations . This can be addressed by:

    • Optimizing expression systems (e.g., using specialized E. coli strains, induction conditions)

    • Testing various detergents for solubilization

    • Employing fusion partners to improve stability and expression

    • Considering cell-free expression systems

  • Functional overlap with other transporters: E. coli possesses multiple metal transporters with overlapping specificities, complicating the isolation of ZupT-specific effects. Researchers typically address this by:

    • Creating multiple knockout strains lacking various combinations of transporters (e.g., ΔznuACB ΔzupT ΔzntA ΔzitB ΔzntB)

    • Using metal-specific chelators to create defined metal-limited conditions

    • Employing heterologous expression in systems lacking similar transporters

  • Distinguishing direct vs. indirect effects: Determining whether phenotypes result directly from ZupT function or from downstream effects of altered metal homeostasis requires:

    • Complementation studies with wild-type and mutant ZupT variants

    • Metal supplementation experiments to restore phenotypes

    • Correlation of phenotypes with direct measurements of metal content

  • Measuring transport kinetics: The low expression levels of native ZupT and the complexity of metal transport make kinetic measurements challenging. Approaches include:

    • Using radioisotopes with high specific activity

    • Developing fluorescent metal sensors for real-time measurements

    • Overexpressing ZupT under controlled conditions

  • Structural characterization: The lack of a high-resolution structure for ZupT limits mechanistic understanding. Current approaches include:

    • Homology modeling based on related transporters

    • Cysteine-scanning mutagenesis to map functionally important regions

    • Pursuing cryo-EM as an alternative to crystallography

These methodological challenges require integrated approaches combining genetic, biochemical, and biophysical techniques to gain comprehensive insights into ZupT function.

How does ZupT contribute to E. coli pathogenesis and virulence?

ZupT contributes to E. coli pathogenesis through several mechanisms, particularly in uropathogenic E. coli (UPEC) strains:

These findings highlight ZupT's role in a network of metal acquisition systems that collectively support bacterial survival during infection, making it a potential target for antibacterial strategies that disrupt metal homeostasis.

What is the significance of ZupT's ability to transport multiple metal ions?

ZupT's ability to transport multiple divalent metal ions (zinc, iron, cobalt, and possibly manganese) has significant implications for bacterial physiology, evolution, and potential applications:

  • Metabolic versatility: This broad specificity allows E. coli to acquire essential metals through a single transporter, providing metabolic flexibility in environments with varying metal availability . This is particularly important given that each of these metals serves as cofactors for different enzymes and cellular processes.

  • Metal homeostasis integration: ZupT's multimetal capability suggests it plays a role in coordinating the homeostasis of different metals. For example, the observation that iron positively regulates zinc activity in ZupT points to complex cross-metal regulatory mechanisms .

  • Evolutionary significance: ZupT represents the first characterized bacterial member of the ZIP family, which is widespread in eukaryotes . Its broad substrate specificity may reflect an ancestral function that has been retained during evolution, while specialized transporters have evolved for high-affinity uptake of specific metals.

  • Structural insights: The binuclear metal transport center of ZupT, with different binding patterns for zinc and iron, provides a unique model system for understanding how transporters can accommodate different ions using distinct but overlapping binding sites .

  • Environmental adaptation: The ability to transport multiple metals through a constitutively expressed transporter may provide a baseline uptake capacity that helps E. coli adapt to new environments before metal-specific regulated transporters can be induced.

  • Potential biotechnological applications: Understanding ZupT's metal transport capabilities could inform the development of engineered bacteria for bioremediation of metal-contaminated environments or for biofortification applications.

This multimetal transport capability distinguishes ZupT from many other more specific transporters and highlights its role as a versatile component in E. coli's metal acquisition toolkit.

How can comparative studies between bacterial and eukaryotic ZIP transporters inform our understanding of metal transport mechanisms?

Comparative studies between bacterial ZupT and eukaryotic ZIP transporters offer valuable insights into fundamental mechanisms of metal transport and their evolution:

  • Conserved structural elements: ZupT shares approximately 32% sequence identity with some eukaryotic ZIP transporters, suggesting conservation of core transport mechanisms across diverse organisms . Comparing the conserved residues can identify the essential components of the transport machinery that have been maintained throughout evolution.

  • Divergent regulatory mechanisms: While the basic transport function is conserved, regulatory mechanisms differ significantly. Eukaryotic ZIPs often show complex transcriptional, post-transcriptional, and post-translational regulation, whereas bacterial ZupT appears constitutively expressed . This comparison can illuminate how regulation has evolved with increasing organismal complexity.

  • Disease relevance: Defects in human ZIP transporters are associated with zinc deficiency, cancer, and cardiovascular disease . The simpler bacterial system provides a model to understand basic transport mechanisms that can then inform studies of the more complex human transporters involved in disease.

  • Metal selectivity determinants: Comparing metal binding sites between bacterial and eukaryotic ZIPs can reveal how selectivity is achieved. For instance, the binuclear center of ZupT with differential binding of zinc and iron provides insights into how subtle changes in coordination chemistry can affect metal preference .

  • Transport energetics: Investigating how bacterial and eukaryotic ZIP transporters couple energy to transport (likely through chemiosmotic gradients rather than ATP hydrolysis) can advance understanding of this less-studied transport mechanism .

  • Heterologous expression approaches: Expression of eukaryotic ZIPs in bacterial systems lacking endogenous transporters (e.g., Arabidopsis thaliana ZIP1 expression in E. coli transport mutants) provides functional insights that may be difficult to obtain in more complex eukaryotic systems .

These comparative approaches not only advance basic understanding of metal transport but also may inform therapeutic strategies targeting metal homeostasis in infectious diseases or metal-related human disorders.

What are the optimal approaches for heterologous expression and purification of ZupT for biochemical studies?

Heterologous expression and purification of ZupT present challenges common to membrane proteins. Based on successful approaches in the literature, the following strategies are recommended:

  • Expression system selection:

    • E. coli C41(DE3) or C43(DE3) strains often yield better results for membrane proteins than standard BL21(DE3)

    • Consider using E. coli strains with deletions in multiple metal transporters (ΔznuACB ΔzupT) to avoid interference from endogenous proteins

    • For difficult constructs, alternative systems such as Lactococcus lactis or insect cells may be considered

  • Construct optimization:

    • Include affinity tags (His6 or His10) at either the N- or C-terminus, with TEV protease cleavage sites

    • Test multiple construct lengths to identify the most stable version

    • Consider fusion partners such as GFP (to monitor expression and folding) or MBP (to enhance solubility)

  • Expression conditions:

    • Use lower induction temperatures (16-20°C) and extended expression times (overnight)

    • Test various inducers and concentrations (e.g., 0.1-0.4 mM IPTG or 50-200 ng/ml AHT for tetracycline-inducible systems)

    • Supplement media with zinc (1-10 μM) to stabilize the protein during expression

  • Membrane extraction and solubilization:

    • Screen multiple detergents including DDM, LMNG, LDAO, and C12E8

    • Consider adding cholesterol hemisuccinate (CHS) to stabilize the protein

    • Maintain zinc in buffers (1-5 μM) during solubilization

  • Purification strategy:

    • Initial capture via immobilized metal affinity chromatography (IMAC)

    • Secondary purification by size exclusion chromatography

    • Consider lipid nanodiscs or amphipols for detergent-free final preparation

  • Quality control:

    • Circular dichroism to verify secondary structure

    • Thermal stability assays to optimize buffer conditions

    • Metal content analysis to confirm binding capacity

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to assess oligomeric state

  • Functional validation:

    • Metal binding assays using isothermal titration calorimetry or fluorescence spectroscopy

    • Reconstitution into proteoliposomes for transport assays

These approaches should be systematically optimized for ZupT, as conditions successful for related transporters may require adjustment due to ZupT's specific characteristics.

What experimental designs best elucidate the interplay between ZupT and other metal transport systems?

To effectively investigate the interplay between ZupT and other metal transport systems in E. coli, researchers should consider the following experimental designs:

  • Genetic approach with systematic mutant combinations:

    • Create single, double, triple, and quadruple knockout strains of various transporters (e.g., ΔzupT, ΔznuACB, ΔzntA, ΔzitB, ΔfeoABC, ΔmntH)

    • For each combination, assess growth in defined media with various metal concentrations and chelators

    • Use complementation with plasmid-borne transporters to confirm phenotypes

  • Metal uptake measurements with radioisotopes:

    • Measure uptake of ⁶⁵Zn²⁺, ⁵⁵Fe²⁺, ⁵⁷Co²⁺ in various mutant combinations

    • Perform competition experiments with non-radioactive metals to assess transport specificity

    • Use time-course measurements to determine initial rates and maximum capacities

  • Metal-dependent gene expression analysis:

    • Use reporter fusions (e.g., Φ(zupT-lacZ)) to monitor expression under various metal conditions

    • Employ RNA-seq to capture global transcriptional responses to deletion of specific transporters

    • Compare expression patterns between wild-type and mutant strains across metal gradients

  • In vivo metal content determination:

    • Use inductively coupled plasma mass spectrometry (ICP-MS) to quantify intracellular metal levels in various mutant combinations

    • Combine with subcellular fractionation to determine metal distribution within cells

    • Correlate metal content with phenotypic effects

  • Cross-complementation studies:

    • Express heterologous transporters (e.g., Arabidopsis thaliana ZIP1) in E. coli transport mutants to assess functional equivalence

    • Systematically replace specific domains between transporters to identify regions responsible for metal specificity or regulatory interactions

  • Physiological stress response measurements:

    • Assess oxidative stress resistance, motility, and biofilm formation in transporter mutants

    • Determine if phenotypes can be rescued by specific metal supplementation

    • Use fluorescent stress reporters to monitor real-time responses

  • In vivo interaction studies:

    • Employ bacterial two-hybrid or split-GFP assays to detect potential physical interactions between transporters or regulatory components

    • Use co-immunoprecipitation followed by mass spectrometry to identify interaction partners

  • Infection models:

    • Use competitive infection experiments in animal models to assess the contribution of different transport systems to virulence

    • Compare tissue-specific effects (e.g., bladder vs. kidney colonization)

    • Analyze metal availability in different host niches

These multifaceted approaches can provide complementary data to build a comprehensive model of how ZupT functions within the broader network of metal transport systems in E. coli.

What are the most informative site-directed mutagenesis targets in ZupT for understanding its transport mechanism?

Based on structural modeling and functional studies, the following site-directed mutagenesis targets in ZupT would be most informative for elucidating its transport mechanism:

For each mutant, comprehensive characterization should include:

  • Metal binding assays with purified protein

  • Transport activity measurements in cells

  • Assessment of metal selectivity profiles

  • Protein stability and membrane localization verification

  • Structural analysis where possible

This systematic mutagenesis approach, guided by structural models and comparative sequence analysis, would provide mechanistic insights into how ZupT accomplishes metal recognition, binding, and translocation across the membrane.

How should researchers interpret discrepancies in ZupT metal transport data from different experimental systems?

Researchers frequently encounter discrepancies in ZupT metal transport data across different experimental systems. These variations require careful interpretation using the following analytical framework:

  • System-specific factors to consider:

    • In vivo vs. in vitro systems: Cellular studies include contributions from other transporters and regulatory systems, while purified protein studies isolate ZupT-specific effects but may lack physiological context .

    • Expression levels: Native vs. overexpressed ZupT may show different apparent specificities due to concentration-dependent effects .

    • Genetic background: Strain-specific differences, particularly in metal homeostasis genes, can influence results. K-12 lab strains vs. pathogenic isolates may show different ZupT dependencies .

    • Media composition: Metal availability, chelators, and competing ions significantly impact transport measurements .

  • Methodological considerations:

    • Direct vs. indirect measurements: Radioisotope uptake directly measures transport, while growth assays reflect the physiological outcome of transport .

    • Time scales: Initial rates vs. steady-state measurements may highlight different aspects of transport kinetics.

    • Measurement sensitivity: Detection limits may obscure low-level transport of secondary substrates.

  • Analytical approaches for resolving discrepancies:

    • Standardize experimental conditions: Use defined minimal media with controlled metal concentrations when comparing across systems.

    • Create systematic controls: Include positive and negative controls specific to each metal (e.g., ΔznuACB for zinc, ΔfeoABC for iron) .

    • Perform dose-response experiments: Measure transport or growth across concentration ranges to detect affinity differences.

    • Conduct competitive inhibition studies: Determine how the presence of one metal affects transport of another to understand selectivity mechanisms .

    • Correlate multiple measurement types: Compare binding, transport, and physiological outcomes within the same experimental setup.

  • Reconciling contradictory findings:

    • Consider that discrepancies may reflect real biological complexity rather than experimental artifacts.

    • ZupT may function differently depending on metal availability and the status of other transport systems.

    • The constitutive but low-level expression of ZupT suggests it may have different roles under different conditions .

    • Remember that iron positively regulates zinc activity in ZupT, indicating complex metal interactions that could contribute to apparently conflicting results .

By systematically analyzing experimental variables and integrating multiple measurement approaches, researchers can transform apparent discrepancies into insights about the context-dependent functioning of ZupT in metal homeostasis networks.

What statistical approaches are most appropriate for analyzing metal transport and binding data for ZupT?

When analyzing metal transport and binding data for ZupT, researchers should employ statistical approaches that account for the unique characteristics of these experimental systems:

These statistical approaches should be selected based on experimental design, data structure, and specific questions being addressed, with attention to appropriate assumptions and limitations of each method.

What are the most promising approaches for determining the high-resolution structure of ZupT?

Determining the high-resolution structure of ZupT remains challenging due to difficulties in membrane protein crystallization. The following approaches show promise for overcoming these obstacles:

  • Cryo-electron microscopy (cryo-EM):

    • Recent advances in detector technology and image processing have revolutionized membrane protein structural biology

    • Advantages include minimal protein requirement, no need for crystallization, and potential to capture multiple conformational states

    • Challenges include ZupT's relatively small size (~30-35 kDa), which may be addressed by:

      • Using antibody fragments or nanobodies to increase molecular weight

      • Employing new Volta phase plates to enhance contrast

      • Considering expression as a fusion with a larger soluble protein

  • X-ray crystallography optimizations:

    • Lipidic cubic phase (LCP) crystallization, which has proven successful for many transporters

    • Systematic screening of detergents, lipids, and stabilizing additives

    • Surface entropy reduction through mutagenesis of flexible regions

    • Co-crystallization with conformation-specific antibody fragments

    • Use of fusion partners specifically designed for membrane protein crystallization (e.g., BRIL, rubredoxin)

  • Protein engineering approaches:

    • Thermostabilizing mutations identified through alanine scanning or computational prediction

    • Creating chimeric proteins with more crystallizable homologs from thermophilic organisms

    • Truncation or modification of flexible regions that might impede crystallization

    • Insertion of crystallization chaperones at specific loop regions

  • Alternative techniques complementing structural studies:

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes during transport

    • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling to measure distances between specific residues

    • Cross-linking mass spectrometry to identify residue proximities

    • Molecular dynamics simulations based on homology models to predict conformational states

  • Structural genomics approach:

    • Screening multiple ZIP family members from diverse bacteria to identify more amenable targets

    • Focusing on extremophile homologs that might possess inherently higher stability

    • Leveraging structural information from eukaryotic ZIP transporters if they become available

  • Integrative structural biology:

    • Combining lower-resolution techniques (small-angle X-ray scattering, negative-stain EM) with computational modeling

    • Using evolutionary coupling analysis to predict residue contacts

    • Validating structural models with functional data from mutagenesis studies

A comprehensive approach integrating multiple methods is likely to yield the most reliable structural insights into ZupT, providing a foundation for understanding its transport mechanism and substrate selectivity at the atomic level.

How might synthetic biology approaches be used to engineer ZupT variants with altered metal specificity?

Synthetic biology offers powerful tools for engineering ZupT variants with customized metal specificity, which could advance both fundamental understanding and potential applications:

  • Structure-guided rational design:

    • Using homology models to identify and modify key residues in the primary (site 1) and secondary (site 2) metal binding sites

    • Altering the coordination geometry by introducing or removing coordinating residues

    • Modifying the electrostatic environment around binding sites to favor specific metals

    • Creating chimeric transporters by swapping metal-binding domains with those from transporters with different specificities

  • Directed evolution approaches:

    • Developing high-throughput screening systems based on:

      • Metal-dependent growth under selection pressure

      • Fluorescent sensors that report on intracellular metal concentrations

      • Genetic circuits linking metal transport to reporter gene expression

    • Applying random mutagenesis followed by selection under conditions favoring transport of target metals

    • Using error-prone PCR with targeted randomization of binding site residues

  • Computational design strategies:

    • Employing molecular dynamics simulations to predict effects of mutations on metal coordination

    • Using machine learning approaches trained on known metal transporters to predict mutations that would alter specificity

    • Applying quantum mechanical calculations to optimize coordination geometry for specific metals

  • Domain swapping and protein fusion:

    • Creating hybrid transporters combining the membrane scaffold of ZupT with metal binding domains from other transporters

    • Engineering allosteric regulation by fusing metal-sensing domains to ZupT

    • Exploring the fusion of multiple ZupT variants to create transporters with multiple specificity determinants

  • De novo design considerations:

    • Designing completely novel metal binding sites within the ZupT scaffold based on first principles of coordination chemistry

    • Creating synthetic binding pockets with non-canonical amino acids to achieve specificities not possible with standard residues

  • Application-focused engineering:

    • For bioremediation: Enhancing selectivity for toxic metals like cadmium or mercury

    • For biofortification: Optimizing iron or zinc uptake without competing metals

    • For biosensing: Creating variants that transport metals only in response to specific signals

  • Testing and validation strategies:

    • Developing quantitative assays for specificity using competition experiments with multiple metals

    • Characterizing engineered variants both in vivo and with purified protein

    • Using X-ray absorption spectroscopy to directly analyze coordination environments in engineered binding sites

These synthetic biology approaches could not only produce ZupT variants with novel properties but also generate fundamental insights into the molecular determinants of metal selectivity in transport proteins. The resulting engineered transporters could find applications in environmental remediation, biofortification of crops, biosensing, and synthetic biology.

What are the implications of ZupT research for developing new antimicrobial strategies?

Research on ZupT and bacterial metal transport systems reveals several promising avenues for novel antimicrobial strategies:

  • Targeting zinc acquisition pathways:

    • While individual deletion of zupT has minimal impact on virulence, the combined disruption of zinc transport systems (ZupT and ZnuACB) significantly attenuates uropathogenic E. coli in urinary tract infection models . This suggests that broad inhibition of zinc acquisition could be an effective antibacterial strategy.

    • Small molecule inhibitors designed to block both ZupT and ZnuACB could synergistically impair bacterial growth in zinc-limited host environments.

    • Such inhibitors might be particularly effective against pathogens in urinary tract infections, where zinc limitations appear critical for virulence .

  • Exploiting metal transport for antimicrobial delivery:

    • ZupT's broad substrate specificity could potentially be exploited as a "Trojan horse" strategy, where toxic metal mimics or metal-antibiotic conjugates are transported into bacterial cells through this uptake system .

    • Since ZupT is constitutively expressed rather than metal-regulated , it could provide a consistent entry route that bacteria cannot easily downregulate to develop resistance.

  • Targeting virulence-related functions:

    • Zinc transport systems support bacterial motility and resistance to oxidative stress, both crucial for virulence .

    • Compounds that specifically inhibit the protective effects of zinc against oxidative damage could enhance bacterial killing by host immune defenses.

    • The link between zinc transport and motility suggests that ZupT inhibitors might reduce bacterial dissemination within the host.

  • Combination therapy approaches:

    • Combining zinc transport inhibitors with oxidative stress-inducing antibiotics could create synergistic effects, as zinc-depleted bacteria show increased susceptibility to hydrogen peroxide .

    • Metal chelators with selectivity for zinc could enhance the efficacy of conventional antibiotics against certain pathogens by compromising essential metabolic functions.

  • Host-directed therapies:

    • Understanding how host nutritional immunity restricts zinc availability could lead to strategies that enhance this natural defense mechanism.

    • Manipulating host metal transporters or metal-binding proteins to further sequester zinc could complement direct antimicrobial approaches.

  • Considerations for antimicrobial development:

    • Potential challenges include selectivity for bacterial versus human zinc transporters, as ZIP family transporters are conserved across kingdoms .

    • The redundancy in bacterial metal acquisition systems necessitates targeting multiple transport pathways simultaneously for effective inhibition.

    • Species-specific differences in metal transport systems must be considered when developing broad-spectrum antimicrobials.

  • Diagnostic and theranostic applications:

    • Knowledge of metal transport systems could inform the development of diagnostic tools that detect bacterial metal acquisition activity as an indicator of infection.

    • Metal-based imaging agents that enter through these transporters might allow visualization of bacterial infections in vivo.

This research area represents a promising alternative to conventional antibiotic targets, potentially addressing issues of antimicrobial resistance by exploiting the fundamental requirement for metal homeostasis in bacterial pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.