Recombinant E. fergusonii cls is a full-length (1–486 amino acids) polypeptide derived from the cls gene of E. fergusonii, expressed in E. coli with an N-terminal histidine (His) tag for purification. Its primary function mirrors that of native cls enzymes: catalyzing the synthesis of cardiolipin, a diphosphatidylglycerol lipid essential for bacterial membrane stability and energy transduction .
The recombinant enzyme’s sequence begins with MTTFYTVVSWLVILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGE... and terminates with FFSPLL . While the exact molecular weight is not explicitly stated, E. coli cls mature protein is typically 46 kDa, suggesting a similar size for E. fergusonii cls .
Cardiolipin synthase catalyzes the condensation of two phosphatidylglycerol molecules to form cardiolipin, a reaction critical for maintaining membrane curvature and proton motive force . In E. coli, cls mutants still synthesize cardiolipin via alternative pathways (e.g., phosphatidylserine synthase), indicating partial redundancy .
Membrane Stability: Cardiolipin stabilizes respiratory complexes and membrane-bound proteins.
Pathogenicity: Altered cardiolipin levels correlate with bacterial virulence in some species.
The recombinant protein is produced in E. coli using plasmid-based expression systems, often under inducible promoters (e.g., T7 promoter). High-copy plasmids can amplify enzyme production, though overexpression may disrupt membrane integrity .
Dispersibility in E. coli: cls mutants grow slower than wild-type strains but remain viable, suggesting cardiolipin synthesis via alternative pathways .
Regulation: cls expression in E. coli is influenced by electron acceptors (e.g., oxygen, nitrate) and growth phase but not autogenously regulated .
Conserved Residues: N-terminal residues (e.g., Leu-7, Val-8) in E. coli cls are critical for proper protein folding and membrane insertion .
KEGG: efe:EFER_1705
Cardiolipin synthase (Cls) is a critical enzyme responsible for the synthesis of cardiolipin (CL), a major phospholipid component in bacterial membranes. In Escherichia species, cardiolipin typically constitutes approximately 5-15% of the total phospholipid content, with the remainder primarily consisting of phosphatidylethanolamine (PE) and phosphatidylglycerol (PG) . The enzyme catalyzes a condensation reaction that, in most characterized systems, involves two phosphatidylglycerol molecules to form cardiolipin and glycerol . This reaction is reversible, allowing phosphatidyl group transfer between molecules under varying cellular conditions . The enzymatic activity is essential for maintaining proper membrane composition, which in turn affects numerous cellular processes including cell division, energy metabolism, and response to environmental stressors . Cardiolipin's unique structure with four acyl chains and two negative charges creates specialized membrane domains that are particularly important for bacterial adaptation to various growth conditions and stress responses .
Escherichia fergusonii cardiolipin synthase shares significant structural similarities with other bacterial cardiolipin synthases, particularly those from E. coli. The E. fergusonii Cls is a membrane-bound protein consisting of 486 amino acids, as indicated by its full-length sequence . Like other bacterial cardiolipin synthases, it belongs to the phospholipase D superfamily . This protein family is characterized by conserved catalytic motifs that are crucial for enzymatic activity.
When comparing bacterial cardiolipin synthases across species, three highly conserved regions become apparent in their amino acid sequences . One region contains a conserved pentapeptide sequence, RN(Q)HRK, while another has a conserved HXK sequence . These conserved regions are likely components of the enzyme's active site and are essential for its catalytic function . The E. fergusonii Cls shares these conserved motifs, suggesting similar catalytic mechanisms across bacterial species. The amino acid sequence of E. fergusonii Cls provided in the product information reveals multiple transmembrane regions and hydrophobic domains consistent with its membrane-embedded localization, which is necessary for accessing its phospholipid substrates .
Multiple growth conditions significantly influence cardiolipin synthase expression and activity in bacteria. In E. coli, which serves as a model for understanding E. fergusonii, several key factors have been identified:
Terminal electron acceptors: Expression of the cls gene is influenced by the available terminal electron acceptor when cells are cultured in minimal medium with glycerol as the carbon source. Expression levels increase in the order of oxygen, nitrate, and fumarate, with fumarate inducing the highest expression . This suggests that cardiolipin synthesis is responsive to changes in respiratory metabolism.
Growth phase: As bacteria progress from early to late logarithmic growth phase under aerobic conditions, cls gene expression increases approximately 2.5-fold . This growth phase-dependent regulation indicates that cardiolipin becomes increasingly important as cells approach stationary phase.
Medium osmolarity: Cardiolipin synthesis by all Cls enzymes increases with rising medium osmolarity during both logarithmic growth and stationary phase . This response likely represents an adaptation mechanism to osmotic stress.
Nutrient availability: The transition to stationary phase, characterized by nutrient limitation, triggers increased cardiolipin synthesis. This suggests that cardiolipin plays a role in adaptation to nutrient-limited conditions .
These regulatory patterns indicate that cardiolipin synthesis is dynamically regulated in response to environmental conditions, allowing bacteria to adjust their membrane composition to optimize survival and function under varying growth circumstances.
The identification of three distinct cardiolipin synthases in E. coli provides important insights that may apply to understanding E. fergusonii Cls systems as well. These three synthases—ClsA (encoded by cls, renamed clsA), ClsB (encoded by ybhO, renamed clsB), and ClsC (encoded by ymdC)—exhibit significant differences in their substrate specificity and regulation:
Substrate specificity:
ClsA and ClsB utilize two phosphatidylglycerol (PG) molecules as substrates, condensing them to form cardiolipin and releasing glycerol .
In contrast, the ClsC system (working in conjunction with YmdB) employs a unique mechanism, using phosphatidylethanolamine (PE) as the phosphatidyl donor to PG to form cardiolipin . This represents a third and distinct mode of cardiolipin synthesis not previously characterized.
Expression patterns and regulation:
During logarithmic growth at low osmolarity, only ClsA contributes detectable levels of cardiolipin .
All three synthases show increased activity with rising medium osmolarity during both logarithmic growth and stationary phase .
In stationary phase, all three enzymes can contribute to cardiolipin synthesis, but their relative contributions vary depending on growth conditions .
Functional cooperation:
ClsC activity is significantly enhanced by co-expression with its neighboring gene, ymdB . When expressed alone, ClsC produces only low levels of cardiolipin, but co-expression with ymdB increases production to near wild-type levels. This suggests a functional interaction or complex formation between these two proteins.
This diversity in cardiolipin synthases demonstrates the importance of this phospholipid for bacterial physiology and suggests specialized roles for each enzyme under different growth conditions. Understanding these differences is crucial for interpreting experimental results involving cardiolipin metabolism in both E. coli and related species like E. fergusonii.
Regulation of cardiolipin synthase occurs at multiple levels, encompassing both genetic expression and enzymatic activity controls:
Genetic regulation:
Terminal electron acceptor influence: The expression of the cls gene varies depending on the terminal electron acceptor available, increasing in the order of oxygen, nitrate, and fumarate . This suggests integration with respiratory metabolism control systems.
Growth phase dependence: cls gene expression increases approximately 2.5-fold as cells progress from early to late log growth phase under aerobic conditions . This indicates growth phase-dependent transcriptional regulation.
Absence of autogenous regulation: Research has demonstrated that cls is not subject to autogenous regulation, as evidenced by experiments showing that manipulating cardiolipin levels through cls gene mutations or plasmid-based cls overexpression did not correspondingly alter cls gene expression .
Enzymatic activity regulation:
Product inhibition: Cardiolipin synthase is inhibited by its own product, cardiolipin (CL), creating a feedback inhibition mechanism .
Phospholipid interactions: The enzyme is also inhibited by phosphatidate . Interestingly, phosphatidylethanolamine can partially offset inhibition caused by cardiolipin but not inhibition caused by phosphatidate, suggesting different inhibitory mechanisms .
Cofactor regulation: While CDP-diacylglycerol does not appear to affect the activity of purified enzyme, it does stimulate activity in crude membrane preparations, indicating potential cofactor requirements or secondary regulatory mechanisms in the native membrane environment .
These multilevel regulatory mechanisms ensure that cardiolipin synthesis is precisely controlled according to cellular needs, environmental conditions, and growth phase, allowing bacteria to maintain optimal membrane composition across varying circumstances.
Disruption of the cls gene produces several notable phenotypic effects, though surprisingly, complete lethality is not observed in most experimental conditions:
Growth characteristics:
cls mutants exhibit longer doubling times compared to wild-type strains, indicating reduced growth efficiency .
Final culture densities are lower in cls mutants than in corresponding wild-type strains, suggesting reduced carrying capacity .
cls null mutants grow reasonably well despite lacking detectable cardiolipin synthase activity, indicating that while beneficial, the enzyme is not absolutely essential under standard laboratory conditions .
Stationary phase effects:
Altered drug susceptibility:
cls mutants show increased resistance to 3,4-dihydroxybutyl-1-phosphonate, a phospholipid metabolism inhibitor .
They also display altered sensitivity to novobiocin, an antibiotic that targets DNA gyrase . This suggests potential interactions between membrane composition and DNA topology maintenance.
Residual cardiolipin production:
Even in cls null mutants, trace quantities of cardiolipin can still be detected, suggesting alternative synthesis pathways .
The cardiolipin content of cls mutants is influenced by the dosage of the pss gene (encoding phosphatidylserine synthase), indicating a relationship between these phospholipid synthesis pathways .
Attempts to transfer a null allele of the cls gene into a pss-1 mutant have been unsuccessful, suggesting that complete absence of both pathways may be lethal .
These findings indicate that while cardiolipin synthase is beneficial for optimal growth and survival, especially under stress conditions, bacteria have evolved redundant mechanisms to maintain minimal cardiolipin levels even in the absence of the primary synthesis pathway.
Based on research with related cardiolipin synthases, optimal conditions for expressing recombinant E. fergusonii cardiolipin synthase should consider multiple factors:
Expression system selection:
E. coli-based expression systems are typically preferred due to the close phylogenetic relationship between E. coli and E. fergusonii, which increases the likelihood of proper folding and post-translational processing .
Consider that native cardiolipin synthase undergoes post-translational processing, as evidenced by the molecular mass of E. coli CL synthase (45-46 kDa) being approximately 8 kDa less than the polypeptide predicted by the gene sequence . Expression systems should maintain this processing capacity.
Growth conditions:
Lower temperatures (16-25°C) during induction often improve the yield of properly folded membrane proteins by slowing protein synthesis and allowing more time for proper membrane insertion.
Given that cls gene expression naturally increases in late logarithmic phase, induction timing should consider growth phase effects .
Since cls expression is influenced by terminal electron acceptors, consider modifying culture aeration or supplying alternative electron acceptors to optimize expression .
Membrane incorporation:
As a membrane protein with multiple transmembrane domains, expression conditions should favor proper membrane insertion rather than cytoplasmic aggregation.
The use of mild detergents during purification is critical to maintain the native conformation and activity of the enzyme.
Storage considerations:
These recommendations are based on general principles for membrane protein expression and specific findings regarding cardiolipin synthase behavior, which should translate to successful expression of the E. fergusonii enzyme.
Accurate assessment of cardiolipin synthase activity requires careful consideration of assay conditions that reflect the enzyme's native environment and catalytic requirements:
By carefully controlling these variables and incorporating appropriate controls, researchers can develop robust assays for characterizing the activity of recombinant E. fergusonii cardiolipin synthase under various experimental conditions.
Initial membrane isolation:
Begin with careful isolation of membrane fractions, as cardiolipin synthase associates primarily with the membrane compartment. In E. coli research, β-galactosidase fusion proteins with cardiolipin synthase were found predominantly in the particulate (membrane) fraction .
Differential centrifugation techniques effectively separate membrane components from cytosolic proteins.
Optimal solubilization approach:
Select detergents carefully to maintain enzyme functionality. Mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin often preserve membrane protein activity better than harsher ionic detergents.
Detergent concentration is critical—sufficient for solubilization but not so high as to denature the protein. Typically, concentrations just above the critical micelle concentration are optimal.
Consider including phospholipids in the solubilization buffer to stabilize the enzyme, particularly phosphatidylethanolamine, which has been shown to counteract some inhibitory effects .
Affinity chromatography optimization:
Incorporate affinity tags (His, FLAG, etc.) at positions least likely to interfere with enzyme function. For cardiolipin synthase, C-terminal tags often preserve functionality better than N-terminal tags due to the membrane topology of the protein.
Include appropriate detergents in all chromatography buffers to maintain protein solubility.
Consider on-column refolding techniques if inclusion body formation is a significant issue.
Activity preservation measures:
Throughout purification, maintain conditions that preserve enzyme activity, including appropriate pH (typically 7-8), ionic strength, and the presence of stabilizing agents.
For storage, a buffer containing 50% glycerol helps maintain enzyme stability at -20°C or -80°C for extended periods .
Minimize freeze-thaw cycles, as repeated freezing and thawing significantly reduces enzyme activity .
Quality control assessments:
Verify enzyme activity at each purification step to ensure the protocol preserves functionality.
Use size exclusion chromatography as a final purification step to confirm the protein exists in the correct oligomeric state and to remove aggregates.
By combining these approaches and carefully monitoring enzyme activity throughout the purification process, researchers can successfully isolate functional recombinant cardiolipin synthase suitable for detailed biochemical and structural studies.
Understanding the distinctions between E. fergusonii cardiolipin synthase and the multiple cardiolipin synthases in E. coli provides valuable insights into evolutionary adaptation and functional specialization:
Sequence and structural comparisons:
E. fergusonii cardiolipin synthase shares significant sequence homology with E. coli cardiolipin synthases, particularly in the conserved catalytic regions containing the pentapeptide sequence RN(Q)HRK and the HXK motif .
The full-length E. fergusonii Cls protein consists of 486 amino acids, with a predicted molecular weight that likely undergoes post-translational processing similar to E. coli Cls .
All these enzymes belong to the phospholipase D superfamily, suggesting a common catalytic mechanism despite potential substrate differences .
Functional specialization:
While E. coli possesses three distinct cardiolipin synthases (ClsA, ClsB, and ClsC) with differential expression patterns and substrate preferences, the specialization pattern in E. fergusonii requires further characterization .
Based on sequence similarities, E. fergusonii Cls may functionally resemble one of the E. coli enzymes more closely, potentially indicating its primary role in phospholipid metabolism.
Substrate utilization:
E. coli ClsA and ClsB utilize two phosphatidylglycerol molecules as substrates, while the ClsC-YmdB system uses phosphatidylethanolamine as the phosphatidyl donor to phosphatidylglycerol .
Determining whether E. fergusonii Cls follows the PG-PG model or the PE-PG model would provide important insights into its evolutionary relationship with the E. coli enzymes.
Regulatory patterns:
E. coli cardiolipin synthases show differential expression based on growth phase and environmental conditions, with ClsA being the primary contributor during logarithmic growth and all three enzymes contributing during stationary phase .
Characterizing the regulatory patterns of E. fergusonii Cls would help determine whether it follows similar regulatory principles or has evolved distinct control mechanisms.
This comparative understanding has important implications for experimental design, as techniques optimized for specific E. coli cardiolipin synthases may require modification when applied to E. fergusonii Cls based on these functional and regulatory differences.
Cardiolipin synthase research provides critical insights into how bacteria adapt their membranes to various environmental stressors:
Osmotic stress adaptation:
Cardiolipin synthesis by all Cls enzymes increases with rising medium osmolarity during both logarithmic growth and stationary phase . This correlation suggests that cardiolipin plays a critical role in membrane adaptation to osmotic challenges.
The unique physical properties of cardiolipin, including its conical shape and ability to form non-bilayer structures, may help stabilize membranes under osmotic stress conditions by affecting membrane curvature and fluidity.
Stationary phase survival:
Cells with mutations in cls have longer doubling times and tend to lose viability more rapidly in stationary phase , indicating cardiolipin's importance in adaptation to nutrient limitation and high cell density environments.
The natural increase in cardiolipin synthesis as cells progress from logarithmic to stationary phase suggests an evolutionary adaptation to enhance survival during nutrient depletion.
Respiratory adaptation:
The influence of terminal electron acceptors on cls gene expression indicates integration of cardiolipin synthesis with respiratory metabolism, potentially optimizing membrane composition for different electron transport chains.
This adaptation may be particularly relevant in environments with fluctuating oxygen availability, where bacteria must switch between aerobic and anaerobic respiration.
Antibiotic resistance implications:
The altered sensitivity of cls mutants to antibiotics like novobiocin suggests that cardiolipin content affects drug interactions with bacterial membranes and potentially contributes to antibiotic resistance mechanisms.
Understanding these interactions could inform the development of new antimicrobial strategies that target membrane composition or exploit vulnerabilities in cardiolipin-deficient strains.
Redundancy in stress responses:
The presence of multiple cardiolipin synthases with different substrate preferences and expression patterns indicates the evolutionary importance of maintaining cardiolipin production under varying conditions.
This redundancy ensures that bacteria can adapt their membrane composition across a wide range of environmental stressors, even if one synthesis pathway is compromised.
These findings highlight the fundamental role of cardiolipin in bacterial stress adaptation and suggest that cardiolipin synthase research has significant implications for understanding bacterial survival mechanisms in challenging environments.
Recombinant E. fergusonii cardiolipin synthase offers several promising applications in synthetic biology, leveraging its unique properties and catalytic capabilities:
Engineering stress-resistant bacterial strains:
Strategic expression of E. fergusonii cardiolipin synthase could enhance bacterial adaptation to stress conditions by modifying membrane composition.
This approach could be particularly valuable for industrial strains used in bioremediation, waste treatment, or biofuel production, where environmental stressors often limit productivity.
Creating customized membrane compositions:
Controlled expression of cardiolipin synthase enables precise modification of phospholipid ratios in bacterial membranes.
Such membrane engineering could enhance the production of membrane proteins, improve cellular tolerance to organic solvents, or optimize the efficiency of membrane-associated bioprocesses.
Developing in vitro phospholipid synthesis systems:
Purified recombinant cardiolipin synthase can be incorporated into cell-free systems for the enzymatic synthesis of cardiolipin and related phospholipids.
This capability enables the production of specialized phospholipids with defined fatty acid compositions for applications in liposome formulation, drug delivery systems, and biomimetic membranes.
Creating biosensors for environmental monitoring:
Given that cardiolipin synthesis responds to various environmental factors, including osmolarity and growth phase , engineered systems incorporating the cardiolipin synthase promoter could serve as biosensors for specific environmental conditions.
These biosensors could detect changes in osmotic pressure, nutrient availability, or other environmental parameters relevant to wastewater treatment, agriculture, or environmental monitoring.
Studying protein-lipid interactions:
Recombinant cardiolipin synthase allows controlled production of cardiolipin for investigating how this unique phospholipid interacts with various membrane proteins.
Such studies could inform the design of new antimicrobial compounds targeting cardiolipin-dependent processes or enhance our understanding of mitochondrial diseases related to cardiolipin metabolism.
Template for protein engineering:
E. fergusonii cardiolipin synthase could serve as a template for protein engineering efforts aimed at creating enzymes with altered substrate specificity or enhanced catalytic efficiency.
Modified versions might catalyze the synthesis of novel phospholipids with unique properties for industrial or biomedical applications.
These applications demonstrate the versatility of recombinant E. fergusonii cardiolipin synthase as a tool in synthetic biology, with potential impacts across biotechnology, medicine, and environmental science.
Researchers working with recombinant cardiolipin synthase frequently encounter several challenges that can be systematically addressed through optimized protocols:
Low expression levels:
Challenge: As a membrane protein, cardiolipin synthase often expresses at lower levels than soluble proteins.
Solution: Consider using specialized expression strains designed for membrane proteins (e.g., C41(DE3) or C43(DE3)), lower induction temperatures (16-20°C), and extended induction periods (16-24 hours). Additionally, codon optimization of the synthetic gene for the expression host can significantly improve translation efficiency.
Protein misfolding and aggregation:
Challenge: Membrane proteins frequently aggregate when overexpressed, forming inclusion bodies with little to no activity.
Solution: Expression with fusion partners that enhance solubility (e.g., MBP, SUMO) can improve folding. Additionally, consider co-expression with chaperones or inclusion of chemical chaperones like glycerol or sucrose in the culture medium. For E. fergusonii Cls, co-expression with partner proteins like YmdB might enhance proper folding and activity, similar to the ClsC-YmdB functional relationship observed in E. coli .
Inefficient membrane integration:
Challenge: Even when expressed, the protein may fail to properly integrate into membranes.
Solution: Ensure expression conditions maintain appropriate membrane fluidity and composition. Consider supplementing growth media with phospholipid precursors or using host strains with altered membrane compositions that favor integration of recombinant membrane proteins.
Loss of activity during purification:
Challenge: Detergent solubilization often strips essential phospholipids and disrupts the native environment of the enzyme.
Solution: Use milder detergents (e.g., digitonin, DDM) and consider including a phospholipid mixture during purification to maintain a lipid annulus around the protein. For cardiolipin synthase, including phosphatidylglycerol in the purification buffers may help maintain the enzyme in an active state.
Post-translational processing issues:
Challenge: E. coli cardiolipin synthase undergoes post-translational processing, with the mature protein being about 8 kDa smaller than predicted from the gene sequence . Failure in this processing could affect activity.
Solution: Express the protein in prokaryotic hosts closely related to the native organism to ensure proper processing. For E. fergusonii Cls, E. coli expression systems are ideal due to the close phylogenetic relationship.
Storage stability problems:
By systematically addressing these challenges, researchers can significantly improve the yield and quality of active recombinant cardiolipin synthase, enabling more detailed biochemical and structural characterization of this important enzyme.
When facing contradictory results in cardiolipin synthase research, a systematic analytical approach can help resolve inconsistencies:
Growth phase considerations:
Contradictory finding: Variable cardiolipin levels between experiments.
Analysis approach: Carefully document and standardize the growth phase at harvest, as cls expression increases approximately 2.5-fold from early to late log phase . Experiments comparing different strains or conditions must use cultures at identical growth stages to avoid misattributing growth phase effects to experimental variables.
Environmental condition variations:
Contradictory finding: Inconsistent enzyme activity or expression between replicate experiments.
Analysis approach: Control for environmental factors known to affect cardiolipin synthase, particularly medium osmolarity and terminal electron acceptor availability . Even minor variations in media composition or aeration can significantly impact cls expression and activity, necessitating strict standardization of culture conditions.
Multiple enzyme isoforms:
Contradictory finding: Residual cardiolipin production in apparent cls knockout strains.
Analysis approach: Consider the presence of multiple cardiolipin synthases with different substrate preferences and expression patterns . In E. coli, complete elimination of cardiolipin requires disruption of all three cls genes (clsA, clsB, and clsC) . Similar redundancy may exist in E. fergusonii, requiring comprehensive genetic analysis rather than focusing on a single enzyme.
Assay condition dependencies:
Contradictory finding: Variable activity measurements of the same enzyme preparation.
Analysis approach: Systematically evaluate how assay conditions affect measured activity. Cardiolipin synthase is subject to complex regulation, including product inhibition and modulation by other phospholipids . Standardize substrate concentrations, detergent types/concentrations, and buffer compositions, and consider how these variables might interact with your specific experimental question.
Post-translational modifications:
Contradictory finding: Discrepancy between protein expression levels and measured activity.
Analysis approach: Investigate post-translational processing, as E. coli cardiolipin synthase undergoes processing that reduces its mass by approximately 8 kDa from the predicted value . Improper processing could result in high expression but low activity. Western blot analysis with antibodies targeting different regions of the protein can help assess processing efficiency.
Protein-protein interactions:
Contradictory finding: Variable activity of purified enzyme compared to membrane-bound forms.
Analysis approach: Consider potential protein-protein interactions affecting activity. The E. coli ClsC-YmdB system demonstrates that some cardiolipin synthases function optimally when co-expressed with partner proteins . Similar dependencies might explain inconsistent activity measures in different experimental contexts.
By systematically evaluating these factors, researchers can often reconcile seemingly contradictory results and develop a more complete understanding of cardiolipin synthase regulation and function.