Recombinant Escherichia fergusonii Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Introduction to the Rnf Complex and RnfE Protein

The Recombinant Escherichia fergusonii Electron Transport Complex Protein RnfE (rnfE) is a subunit of the Rnf (Rhodobacter nitrogen fixation) complex, a membrane-bound ion-translocating electron transport system. This complex plays a critical role in coupling electron transfer between ferredoxin and NAD+ to drive sodium (Na+) or proton (H+) translocation across bacterial membranes . In E. fergusonii, RnfE is part of a multi-subunit complex (RnfABCDGE) involved in energy conservation and redox balancing under anaerobic conditions . Recombinant production enables biochemical and structural studies of this essential metabolic machinery.

Functional Role in Electron Transport

The Rnf complex catalyzes the exergonic electron transfer from reduced ferredoxin (Fd<sub>red</sub>) to NAD+, coupled with Na+ translocation . RnfE contributes to:

  • Energy conservation: Generates a sodium motive force for ATP synthesis .

  • Redox balancing: Maintains cellular NADH/NAD+ ratios during anaerobic metabolism .

  • Cellular resilience: Supports survival under stress conditions (e.g., oxidative stress) .

In E. fergusonii, RnfE’s activity is critical for pathways like caffeyl-CoA reduction, linking electron transport to biosynthetic processes .

5.1. Conservation Across Bacterial Lineages

  • Rnf complexes are highly conserved in anaerobic and facultative bacteria, including A. woodii and R. capsulatus .

  • E. fergusonii RnfE shares <30% sequence identity with E. coli homologs, reflecting functional specialization .

5.2. Biotechnological Applications

  • Metabolic engineering: RnfE is a target for optimizing microbial electrosynthesis and biofuel production .

  • Antimicrobial research: While not directly involved in antibiotic efflux, Rnf complexes influence bacterial persistence under host-like conditions .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Important: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type preferences, please inform us and we will prioritize developing the specified tag.
Synonyms
rsxE; EFER_1411; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
rsxE
Target Protein Sequence
MSEIKDVIVQGLWKNNSALVQLLGMCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR RWTPTEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFAIGMGATGAMFVLGAMREIIGNGTLFDGADALLGNWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDEKMKKRRAKTVVNEIPAGETGKV
Uniprot No.

Target Background

Function
This protein is part of a membrane-bound complex that couples electron transfer with ion translocation across the membrane. It is essential for maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Rnf complex and what role does RnfE play within it?

The Rnf complex is an ion-motive electron transport chain that energetically couples cellular ferredoxin to the pyridine nucleotide pool. It functions as a membrane-bound, Na+-translocating ferredoxin:NAD+ oxidoreductase in many anaerobic bacteria and archaea .

RnfE is one of six subunits (typically RnfA, B, C, D, E, and G) that form the complete Rnf complex. The subunits work together to create a membrane-integral complex containing FeS clusters and flavins as electron carriers . Within this complex, RnfE plays a critical role in the electron transport chain that covers the redox range more negative than -320 mV, which has been historically overlooked in bioenergetic research .

In some organisms like Acetobacterium woodii, the Rnf complex catalyzes electron transfer from reduced ferredoxin (E0' = -500 to -450 mV) to NAD+ (E0' = -320 mV), coupling this to electrogenic translocation of Na+ ions across the membrane .

How does Escherichia fergusonii differ from other Escherichia species in terms of electron transport systems?

Escherichia fergusonii possesses distinct electron transport systems compared to other Escherichia species, particularly E. coli. While E. coli strains belonging to phylogroups A, B1, and C (traditionally classified as environmental isolates) lack certain transport systems, E. fergusonii has evolved different modes of genetic regulation .

One significant difference is that E. fergusonii has been found to evolve more rapidly compared to E. coli . This rapid evolution has implications for its electron transport systems, including the Rnf complex. Additionally, while E. coli is generally reported to have six RND pumps (AcrB, AcrD, AcrF, MdtBC, MdtF, and CusA), E. fergusonii may have differences in its complement of transport systems .

The Rnf complex in E. fergusonii shows similarities to the Na+-translocating NADH:ubiquinone oxidoreductase (Nqr) found in other bacteria, but with unique structural and functional characteristics that distinguish it from homologous systems in other species .

What are the structural characteristics of recombinant RnfE protein from E. fergusonii?

The recombinant full-length Escherichia fergusonii Electron transport complex protein RnfE (rnfE) has the following structural characteristics:

  • Protein length: Full length (1-230 amino acids)

  • Molecular identifier: B7LQN8 in protein databases

  • Amino acid sequence: MSEIKDVIVQGLWKNNSALVQLLGMCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLRRWTPTEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPALSALDGFAIGMGATGAMFVLGAMREIIGNGTLFDGADALLGNWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLMLAGKYLIDEKMKKRRAKTVVNEIPAGETGKV

When expressed as a recombinant protein, RnfE is typically fused to an N-terminal His tag to facilitate purification and detection. The protein is membrane-integral, with transmembrane domains that anchor it within the cell membrane, consistent with its role in the Rnf complex as an electron transport component .

Structural predictions using methods like AlphaFold could provide additional insights into the three-dimensional configuration of RnfE, though experimental structures resolved by techniques such as cryo-electron microscopy would give more definitive structural information .

What experimental design is optimal for studying the function of recombinant RnfE in electron transport?

An optimal experimental design for studying recombinant RnfE function requires a multi-faceted approach:

Block Design for Activity Assays:
Implement a block design experiment alternating between activity periods and control periods . This design is particularly useful for assessing electron transport activity where baseline measurements are crucial for comparison.

Recommended Experimental Setup:

  • Membrane Vesicle Preparation:

    • Prepare inverted membrane vesicles containing the recombinant RnfE protein

    • Ensure proper orientation for measuring Na+ transport into vesicles

    • Include appropriate controls with vesicles lacking RnfE

  • Electron Transport Measurement:

    • Measure ferredoxin-dependent NAD+ reduction

    • Monitor 22Na+ transport coupled to electron flow

    • Test electrogenic properties using ionophores (e.g., ETH2120)

    • Include protonophore controls to distinguish Na+ vs. H+ transport

  • Variables to Control:

    ParameterControl MethodMeasurement
    TemperatureMaintain at 30°CDirect monitoring
    pHBuffer at physiological range (7.0-7.5)pH electrode
    Redox stateTitrate with electron donors/acceptorsRedox electrodes
    Na+ concentrationDefined media compositionIon-selective electrode
  • Recommended Controls:

    • Negative control: Denatured RnfE

    • Substrate specificity: Alternative electron donors/acceptors

    • Inhibitor studies: Specific Rnf complex inhibitors

    • Mutational analysis: Key residue substitutions in RnfE

This block design allows for statistical analysis of activity differences while controlling for time-dependent effects and experimental drift .

How can recent advances in cryo-electron microscopy be applied to study the structural dynamics of RnfE within the Rnf complex?

Recent advances in cryo-electron microscopy (cryo-EM) offer powerful approaches to study RnfE structural dynamics:

Redox-Controlled Cryo-EM Methodology:

  • Sample Preparation:

    • Express and purify the entire Rnf complex with the RnfE component

    • Reconstitute in nanodiscs or detergent micelles to maintain native membrane environment

    • Prepare samples in different redox states using defined redox buffers

  • Redox State Trapping:

    • Utilize rapid freezing techniques to capture transient conformational states

    • Apply redox-controlled conditions to synchronize the complex in specific functional states

    • Use chemical crosslinking to stabilize protein-protein interactions within the complex

  • Data Collection and Processing:

    • Collect images at high magnification (≥40,000×) with a direct electron detector

    • Process using motion correction and contrast transfer function estimation

    • Apply 3D classification to identify different conformational states

    • Perform focused refinement on the RnfE portion of the complex

  • Integration with Computational Methods:

    • Combine cryo-EM structures with molecular dynamics simulations

    • Analyze Na+ binding sites and electron transfer pathways

    • Model conformational changes associated with the redox cycle

Recent research has successfully used redox-controlled cryo-EM to resolve key functional states along the electron transfer pathway in the Na+-pumping Rnf complex from Acetobacterium woodii . This approach revealed that reduction of the unique membrane-embedded [2Fe2S] cluster electrostatically attracts Na+, triggering an inward/outward transition with alternating membrane access that drives the Na+ pump and NAD+ reduction .

Similar methodologies could be applied specifically to E. fergusonii RnfE to understand its unique structural features and functional role within the complex.

What approaches can be used to investigate the role of RnfE in Na+ transport and how does this contribute to the bioenergetics of E. fergusonii?

Investigating RnfE's role in Na+ transport requires a combination of biochemical, biophysical, and genetic approaches:

Comprehensive Investigation Strategy:

What are the common challenges in expressing and purifying functional recombinant RnfE protein?

Expressing and purifying functional RnfE presents several challenges that researchers frequently encounter:

Common Challenges and Solutions:

  • Membrane Protein Solubility Issues:

    • Challenge: As a membrane protein, RnfE tends to aggregate during expression and purification.

    • Solution: Optimize detergent selection through screening multiple detergents (DDM, LMNG, DMNG) at varying concentrations. Alternative approaches include using amphipols or nanodiscs for stabilization.

  • Maintaining Native Structure:

    • Challenge: Loss of native conformation during purification.

    • Solution: Include stabilizing agents (glycerol 10-20%, reducing agents) in all buffers. Consider co-expression with other Rnf complex components to promote proper folding.

  • Low Expression Yields:

    • Challenge: Membrane proteins often express at lower levels than soluble proteins.

    • Solution: Optimize expression conditions using different E. coli strains (C41(DE3), C43(DE3), or Lemo21(DE3)) specifically designed for membrane proteins. Test various induction temperatures (16-30°C) and inducer concentrations.

  • Protein Degradation:

    • Challenge: Proteolytic degradation during expression and purification.

    • Solution: Add protease inhibitors to all buffers and work at reduced temperatures (4°C). Consider using strains lacking specific proteases.

  • Functional Assessment:

    • Challenge: Determining if purified RnfE retains functional activity.

    • Solution: Develop activity assays that can work with the isolated subunit or reconstitute with other Rnf components to measure electron transport activity.

Purification Protocol Optimization Table:

StageCommon IssueOptimization StrategySuccess Indicator
Cell lysisIncomplete membrane solubilizationIncrease detergent concentration; extend solubilization timeClear lysate without visible aggregates
IMAC purificationNon-specific bindingInclude low imidazole (10-20 mM) in washing bufferPure band on SDS-PAGE
Size exclusionAggregationAdd glycerol; optimize detergent type and concentrationMonodisperse peak on chromatogram
StorageActivity lossStore with glycerol at -80°C; avoid freeze-thaw cyclesRetained activity in functional assays

By addressing these challenges systematically, researchers can improve the yield and quality of functionally active recombinant RnfE protein .

How can researchers resolve discrepancies in experimental data when studying RnfE function across different experimental conditions?

Resolving data discrepancies requires systematic analysis and standardization:

Data Discrepancy Resolution Framework:

  • Standardize Experimental Conditions:

    • Develop a standard operating procedure (SOP) for RnfE experiments

    • Control key variables: temperature, pH, ionic strength, redox potential

    • Document all buffer compositions precisely, including detergent concentrations

  • Cross-validation Approaches:

    • Use multiple independent methods to measure the same parameter

    • For Na+ transport: combine radioactive (22Na+), fluorescent, and electrode-based methods

    • For electron transfer: use multiple spectroscopic techniques (UV-Vis, EPR, fluorescence)

  • Statistical Analysis Protocol:

    • Calculate statistical power needed based on observed variability

    • Apply appropriate statistical tests (ANOVA, t-tests) based on data distribution

    • Use Bland-Altman plots to compare methods systematically

  • Common Sources of Discrepancies and Solutions:

    Discrepancy SourceDiagnostic ApproachResolution Strategy
    Protein stability variationCircular dichroism before assaysStandardize storage conditions
    Detergent interferenceTest multiple detergent typesIdentify optimal detergent for all assays
    Redox state differencesSpectroscopic monitoringPre-equilibrate with defined redox buffers
    Na+ contaminationICP-MS analysis of all solutionsPrepare buffers with ultrapure reagents
    Method-specific artifactsCompare results from independent methodsDevelop correction factors based on standards
  • Data Integration:

    • Develop mathematical models that can integrate data from multiple experimental approaches

    • Use Bayesian analysis to update model parameters based on new experimental evidence

    • Document all assumptions and limitations explicitly

By implementing this systematic approach, researchers can identify the sources of experimental discrepancies and develop more robust and reproducible protocols for studying RnfE function .

How do recent structural studies of the Rnf complex inform our understanding of RnfE function in E. fergusonii?

Recent structural studies have significantly advanced our understanding of Rnf complexes and provide valuable insights into E. fergusonii RnfE function:

Key Structural Insights:

  • Cryo-EM Structural Determinations:
    Recent research using redox-controlled cryo-electron microscopy has resolved key functional states along the electron transfer pathway in the Na+-pumping Rnf complex from Acetobacterium woodii . These studies provide a structural framework that likely applies to the E. fergusonii complex with some species-specific variations.

  • Na+ Binding and Translocation Mechanism:
    Structural studies have revealed that reduction of the unique membrane-embedded [2Fe2S] cluster electrostatically attracts Na+, triggering an inward/outward transition with alternating membrane access . This mechanism is likely conserved in E. fergusonii RnfE, providing insight into how electron transfer is coupled to ion translocation.

  • Structural Basis for Evolutionary Relationships:
    The Rnf complex is considered the evolutionary predecessor of the Na+-pumping NADH-quinone oxidoreductase (Nqr) . Structural studies help elucidate how E. fergusonii RnfE fits within this evolutionary context and may explain functional adaptations specific to this organism.

  • AlphaFold and Computational Modeling:
    Recent advances in protein structure prediction using AI systems like AlphaFold can provide additional structural insights, especially when combined with experimental data. These computational models help identify key functional residues and structural elements in RnfE that might be targeted for mutational studies.

Implications for E. fergusonii RnfE Function:

  • Species-Specific Adaptations:
    E. fergusonii has evolved more rapidly compared to E. coli , suggesting potential adaptations in its energy conservation mechanisms. Structural studies may reveal unique features of E. fergusonii RnfE that contribute to its ecological niche or pathogenic potential.

  • Integration with Virulence and Metabolism:
    Understanding RnfE structure helps explain how energy conservation through the Rnf complex is integrated with virulence mechanisms in E. fergusonii, which has been identified as an emerging pathogen with antimicrobial resistance capabilities .

  • Future Research Directions:
    Structural insights suggest several promising research avenues:

    • Site-directed mutagenesis of key residues identified in structural studies

    • Comparative analysis of Rnf complexes across different E. fergusonii strains

    • Structure-guided design of specific inhibitors as potential antimicrobials

These structural advances provide a molecular framework for understanding how E. fergusonii RnfE functions within the Rnf complex and contributes to the organism's bioenergetics and pathogenicity .

What new experimental techniques are emerging that could advance our understanding of RnfE function?

Several cutting-edge experimental techniques are emerging that could revolutionize RnfE research:

Emerging Techniques for RnfE Research:

  • Time-Resolved Cryo-EM:

    • Application: Capturing transient conformational states during the electron transport cycle

    • Advantage: Provides dynamic structural information across millisecond timescales

    • Implementation: Use microfluidic mixing devices coupled with rapid freezing to trap RnfE in different functional states during electron transport and Na+ translocation

  • Single-Molecule FRET (smFRET):

    • Application: Monitoring real-time conformational changes in individual RnfE molecules

    • Advantage: Reveals heterogeneity and intermediate states masked in ensemble measurements

    • Implementation: Introduce fluorescent labels at strategic positions in RnfE to track domain movements during electron transport

  • In-cell NMR and EPR:

    • Application: Studying RnfE structure and dynamics in its native cellular environment

    • Advantage: Avoids artifacts associated with protein purification and reconstitution

    • Implementation: Express isotope-labeled RnfE in E. coli cells and perform spectroscopic measurements in vivo

  • Native Mass Spectrometry:

    • Application: Analyzing intact Rnf complex composition and subunit stoichiometry

    • Advantage: Preserves non-covalent interactions and reveals subcomplexes

    • Implementation: Use nanospray ionization with optimized detergent removal to maintain complex integrity

  • Nanobody-Assisted Structural Biology:

    • Application: Stabilizing specific conformational states of RnfE for structural studies

    • Advantage: Enables capture of transient states that would otherwise be difficult to characterize

    • Implementation: Generate nanobodies against RnfE, select those that bind specific conformations, and use them as crystallization chaperones

  • CRISPR-Based Transcriptional Regulation:

    • Application: Precise control of rnfE expression in native host

    • Advantage: Allows titration of RnfE levels to study dose-dependent effects on bioenergetics

    • Implementation: Design CRISPR interference or activation systems targeting the rnfE promoter

Integration of Techniques: A Proposed Workflow

Research PhasePrimary TechniqueComplementary MethodExpected Outcome
Expression analysisRNA-SeqRibosome profilingRegulation patterns of rnfE gene
Protein localizationSuper-resolution microscopyProximity labelingSpatial organization within membrane
Structural dynamicsTime-resolved cryo-EMMolecular dynamics simulationsConformational changes during function
Functional analysisPatch-clamp electrophysiologySingle-molecule force spectroscopyIon transport kinetics and energetics
In vivo integrationMetabolic flux analysisIn vivo redox sensorsSystem-level role in cellular bioenergetics

By integrating these emerging techniques, researchers can develop a comprehensive understanding of RnfE function that spans from atomic-level structural dynamics to system-level bioenergetic contributions .

How might understanding RnfE function contribute to addressing antimicrobial resistance in E. fergusonii?

Understanding RnfE function offers promising avenues for combating antimicrobial resistance in E. fergusonii:

RnfE as a Target for Antimicrobial Development:

  • Bioenergetic Vulnerability:
    The Rnf complex is essential for energy conservation in many anaerobic bacteria, including E. fergusonii. Disrupting RnfE function could compromise cellular bioenergetics, potentially creating a novel class of antimicrobials that target energy generation rather than conventional targets like cell wall synthesis or protein translation .

  • Specificity Advantages:

    • Human cells lack the Rnf complex, reducing potential toxicity

    • Structural differences between bacterial species could allow for selective targeting

    • Targeting bioenergetic systems may be less susceptible to existing resistance mechanisms

  • Combination Therapy Approach:
    Inhibitors of RnfE could potentially sensitize resistant E. fergusonii to conventional antibiotics by:

    • Reducing energy available for efflux pump activity

    • Compromising membrane potential needed for certain resistance mechanisms

    • Limiting ATP availability for repair processes

Research Strategies for Antimicrobial Development:

  • Structure-Based Drug Design Pipeline:

    • Use high-resolution structures of RnfE to identify druggable pockets

    • Conduct virtual screening of compound libraries against these targets

    • Validate hits with biochemical assays measuring electron transport and Na+ pumping

  • Decoupling Strategy:

    • Design compounds that specifically disrupt the coupling between electron transport and Na+ translocation

    • Target the conformational changes identified in recent structural studies

    • Develop molecules that compete with Na+ binding sites without blocking electron transport

  • Alternative Approach: Vaccine Development:
    Recent studies have explored multi-epitope vaccine design against E. fergusonii . Knowledge of RnfE structure and function could inform vaccine strategies by:

    • Identifying surface-exposed, conserved epitopes in RnfE

    • Targeting regions essential for Rnf complex assembly

    • Developing antibodies that disrupt energy conservation

Addressing Resistance Mechanisms in E. fergusonii:

Resistance MechanismRole of RnfEPotential Intervention
Efflux pumpsProvides energy for pump operationRnfE inhibitors would reduce ATP availability
Metabolic adaptationsSupports altered metabolism in resistant strainsTargeting RnfE could limit metabolic flexibility
Biofilm formationContributes to energy needed for extracellular matrixDisrupting RnfE could impair biofilm development
Persister cell formationMay play role in energy-depleted persister stateModulating RnfE function could affect persister formation

E. fergusonii has been identified as an underrated repository for antimicrobial resistance genes , with many isolates showing multidrug resistance. Understanding and targeting the bioenergetic systems dependent on RnfE offers a promising approach to developing new strategies against this emerging pathogen .

How can research on E. fergusonii RnfE inform bioenergetic studies in other bacterial species?

Research on E. fergusonii RnfE provides valuable insights applicable to diverse bacterial species:

Comparative Bioenergetics Applications:

  • Evolutionary Insights:
    E. fergusonii has evolved more rapidly compared to E. coli , making it an excellent model for studying the diversification of energy conservation mechanisms. Comparative analysis of RnfE across species can reveal:

    • Adaptive changes in response to different ecological niches

    • Evolutionary transitions between Na+ and H+ coupling specificity

    • Functional adaptations related to metabolic capabilities

  • Experimental System for Na+ Bioenergetics:
    The Na+-pumping Rnf complex in E. fergusonii can serve as a model system for studying Na+ bioenergetics in bacteria that are more difficult to cultivate or manipulate genetically, such as:

    • Strictly anaerobic human gut symbionts

    • Marine bacteria adapted to high Na+ environments

    • Alkaliphilic bacteria using Na+ cycles for pH homeostasis

  • Transferable Methodologies:
    Techniques developed for studying E. fergusonii RnfE can be applied to other bioenergetic systems:

    MethodologyApplication in E. fergusoniiTransfer to Other Systems
    Redox-controlled cryo-EMCapturing RnfE conformational statesApplicable to other redox-driven ion pumps
    Na+ transport assaysMeasuring RnfE-mediated ion movementAdaptable to other Na+-translocating complexes
    Genetic system for Rnf manipulationEngineering RnfE variantsTemplate for genetic tools in related species
  • Bioenergetic Network Modeling:
    Understanding E. fergusonii RnfE function enables the development of systems biology models that can be adapted to other species:

    • Flux balance analysis incorporating Rnf-driven energy conservation

    • Kinetic models of redox balancing in fermentative metabolism

    • Integration of electron transport with carbon and nitrogen metabolism

  • Biotechnological Applications:
    Knowledge gained from E. fergusonii RnfE research can inform:

    • Engineering of more efficient biofuel-producing organisms

    • Development of whole-cell biocatalysts for chemical synthesis

    • Design of bacterial strains with enhanced environmental tolerance

Cross-Species Comparative Analysis:

The Rnf complex has been identified in diverse bacteria including Acetobacterium woodii , Methanosarcina acetivorans , Bacteroides fragilis , and many others. Comparing RnfE function across these species can elucidate:

  • Species-specific adaptations in ion specificity (Na+ vs. H+)

  • Variations in electron donor/acceptor preferences

  • Differential energy conservation efficiencies

  • Integration with distinct metabolic pathways

Through these comparative approaches, research on E. fergusonii RnfE contributes to a broader understanding of bacterial bioenergetics and energy conservation mechanisms .

What are the critical parameters to consider when designing experiments to measure electron transport rates through the RnfE protein?

Accurate measurement of electron transport through RnfE requires careful attention to several critical parameters:

Experimental Design Critical Parameters:

  • Redox Potential Control:

    • Importance: RnfE functions within specific redox windows; small variations can dramatically affect electron transport rates.

    • Implementation: Use precisely calibrated redox buffers (e.g., ferredoxin:ferredoxin+ ratios, NAD+:NADH ratios).

    • Measurement: Continuously monitor with redox electrodes or redox-sensitive dyes.

  • Membrane Environment Reconstitution:

    • Importance: RnfE is membrane-integral; its activity depends on lipid composition and membrane properties.

    • Implementation: Test multiple reconstitution methods (liposomes, nanodiscs, proteoliposomes).

    • Consideration: Match lipid composition to E. fergusonii native membrane when possible.

  • Ion Gradients and Membrane Potential:

    • Importance: Na+ gradients and membrane potential affect RnfE electron transport directionality and rate.

    • Implementation: Establish defined Na+ gradients using specific buffer compositions.

    • Measurement: Monitor membrane potential using voltage-sensitive dyes (e.g., DiSC3(5), Oxonol VI).

  • Electron Donor/Acceptor Accessibility:

    • Importance: Ensuring consistent access of electron carriers to their binding sites.

    • Implementation: Optimize protein orientation in reconstituted systems.

    • Control: Use membrane-impermeable and membrane-permeable electron carriers to verify orientation.

Methodological Parameter Optimization Table:

ParameterCritical RangeOptimization ApproachValidation Method
pH6.5-8.0Test at 0.5 pH incrementsActivity vs. pH curve
Temperature25-40°CThermal stability analysisCD spectroscopy at variable temperatures
Ionic strength50-200 mMTitration seriesActivity vs. salt concentration
Detergent concentrationCMC to 5× CMCDetergent screeningSize-exclusion chromatography profiles
Na+ concentration1-100 mMNa+ titration22Na+ binding assays
Redox potential-550 to -300 mVPotentiometric titrationSpectroscopic monitoring of redox centers

Rate Measurement Techniques:

  • Spectrophotometric Assays:

    • Real-time monitoring of NAD+ reduction (340 nm) or ferredoxin oxidation

    • Time resolution: seconds to minutes

    • Advantages: Widely accessible equipment, quantitative

  • Amperometric Methods:

    • Direct measurement of electron flow using electrodes

    • Time resolution: milliseconds

    • Advantages: Real-time kinetics, can measure directionality

  • Radiolabeled Tracer Methods:

    • Using 3H-labeled NAD+ or 14C-labeled substrates

    • Time resolution: minutes

    • Advantages: High sensitivity, can work with crude preparations

Data Analysis Considerations:

  • Correct for background rates using appropriate controls (heat-inactivated RnfE)

  • Account for potential substrate limitation in extended assays

  • Apply appropriate enzyme kinetic models (Michaelis-Menten or more complex models if cooperativity exists)

  • Consider the stoichiometry of electron transfer and ion transport in data interpretation

By carefully controlling these parameters, researchers can obtain reproducible and physiologically relevant measurements of electron transport through the RnfE protein .

What computational modeling approaches can best predict the interaction between RnfE and other components of the electron transport complex?

Advanced computational approaches offer powerful tools for predicting RnfE interactions:

Computational Modeling Framework:

  • Protein Structure Prediction:

    • AlphaFold2 Implementation: Generate high-confidence structural models of RnfE and other Rnf components

    • Refinement Strategy: Integrate experimental constraints from cross-linking or EPR data

    • Validation Approach: Compare predictions with available structural data for homologous proteins

  • Protein-Protein Docking:

    • Rigid Body Docking: Initial placement using programs like HADDOCK or ClusPro

    • Flexible Docking: Account for conformational changes using ensemble approaches

    • Knowledge-Based Constraints: Incorporate evolutionary coupling data from multiple sequence alignments

    • Scoring Function Optimization: Customize for membrane protein interactions in the Rnf complex

  • Molecular Dynamics Simulations:

    • System Setup: Embed the entire Rnf complex in a lipid bilayer mimicking E. fergusonii membrane

    • Force Field Selection: CHARMM36m or AMBER lipid14 with parameters optimized for membrane proteins

    • Simulation Scales:

      • All-atom: For detailed interactions (10-100 ns)

      • Coarse-grained: For large-scale movements and assembly (μs-ms)

    • Analysis Focus: Stable interaction networks, conformational changes, ion and electron pathways

  • Quantum Mechanics/Molecular Mechanics (QM/MM):

    • Application: Model electron transfer reactions through redox centers

    • QM Region: Iron-sulfur clusters and adjacent amino acids

    • MM Region: Remainder of protein and membrane environment

    • Key Calculations: Electron transfer rates, reorganization energies, redox potentials

Integration with Experimental Data:

Computational ApproachExperimental Data SourceIntegration Method
Homology modelingCryo-EM density mapsFlexible fitting of models into maps
DockingCross-linking mass spectrometryDistance restraints in docking algorithms
MD simulationsHydrogen-deuterium exchangeValidation of predicted flexible regions
QM/MM calculationsEPR spectroscopyValidation of electronic structure predictions
Coevolution analysisMutagenesis dataVerification of predicted interaction interfaces

Specialized Analyses for RnfE:

  • Electrostatic Surface Mapping:

    • Calculate electrostatic potentials to identify Na+ binding sites

    • Predict how reduction of [2Fe2S] clusters alters Na+ attraction

    • Map potential electron transfer pathways through the complex

  • Membrane Protein-Specific Tools:

    • Predict transmembrane regions and topology using MEMSAT-SVM

    • Model lipid-protein interactions using specialized force fields

    • Account for membrane deformation around the protein complex

  • Network Analysis of Coupled Movements:

    • Identify allosteric networks connecting electron transfer sites to Na+ binding sites

    • Apply community network analysis to MD trajectories

    • Predict residues critical for coupling electron transport to ion translocation

By integrating these computational approaches with experimental validation, researchers can develop detailed models of how RnfE interacts with other components of the electron transport complex and contributes to energy conservation in E. fergusonii .

What are the recommended protocols for handling and storing recombinant E. fergusonii RnfE protein to maintain optimal activity?

The following comprehensive protocol ensures optimal handling and storage of recombinant RnfE:

Detailed Handling and Storage Protocol:

  • Initial Handling Upon Receipt:

    • Store lyophilized protein at -20°C upon receipt

    • Briefly centrifuge vial before opening to bring contents to bottom

    • Avoid repeated freeze-thaw cycles of the lyophilized powder

  • Reconstitution Procedure:

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • For long-term storage, add glycerol to 5-50% final concentration (recommended: 50%)

    • Aliquot solution into single-use volumes to avoid repeated freeze-thaw cycles

  • Storage Conditions Matrix:

    Storage DurationTemperatureBuffer CompositionContainer Type
    <1 week4°CTris/PBS-based, pH 8.0, 6% TrehaloseLow-binding microcentrifuge tubes
    <1 month-20°CAdd 20-50% glycerolScrew-cap cryovials
    >1 month-80°CAdd 50% glycerolScrew-cap cryovials
  • Activity Preservation Strategies:

    • Include reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) in all buffers

    • Add protease inhibitor cocktail when working with the protein

    • Maintain anaerobic conditions when possible, especially during functional assays

    • Use oxygen-scavenging systems (glucose oxidase/catalase) for sensitive experiments

  • Quality Control Timeline:

    Time PointQC TestAcceptance Criteria
    Upon reconstitutionSDS-PAGESingle band at expected MW
    Before each useUV-Vis spectroscopyCharacteristic Fe-S cluster absorbance
    Monthly (stored samples)Activity assay>70% of initial activity
    After buffer exchangeCircular dichroismPreserved secondary structure
  • Handling for Specific Applications:

    • Crystallization: Use fresh protein preparations; avoid multiple freeze-thaw cycles

    • Functional Assays: Pre-equilibrate to room temperature gradually

    • Structural Studies: Verify protein integrity by size-exclusion chromatography

    • Binding Studies: Remove glycerol by dialysis or buffer exchange prior to assays

  • Troubleshooting Common Issues:

    ObservationPotential CauseSolution
    Protein precipitationDetergent concentration too lowIncrease detergent above CMC
    Activity lossOxidation of Fe-S clustersAdd reducing agents; handle anaerobically
    Aggregation on thawingToo rapid temperature changeThaw slowly on ice
    Degradation bands on SDS-PAGEProtease contaminationAdd fresh protease inhibitors

These protocols are designed to maintain the structural integrity and functional activity of recombinant E. fergusonii RnfE protein, optimizing its utility for research applications .

What are the key resources and databases for researchers studying E. fergusonii RnfE and related electron transport proteins?

An extensive collection of resources is available for RnfE research:

Comprehensive Resource Guide:

  • Protein Sequence and Structure Databases:

    DatabaseURLSpecific Content for RnfE Research
    UniProthttps://www.uniprot.org/RnfE entry (B7LQN8), annotation, sequence features
    Protein Data Bank (PDB)https://www.rcsb.org/Related Rnf complex structures
    AlphaFold Protein Structure DBhttps://alphafold.ebi.ac.uk/Predicted structures of E. fergusonii RnfE
    Pfamhttp://pfam.xfam.org/Domain architecture and evolutionary relationships
    NCBI Proteinhttps://www.ncbi.nlm.nih.gov/protein/RnfE sequences across bacterial species
  • Genomic Resources:

    DatabaseURLUtility for RnfE Research
    NCBI Genomehttps://www.ncbi.nlm.nih.gov/genome/?term=Escherichia+fergusoniiComplete E. fergusonii genomes
    NCBI Datasetshttps://www.ncbi.nlm.nih.gov/datasets/genome/?taxon=564Proteomic data from all 56 sequenced strains
    Ensembl Bacteriahttps://bacteria.ensembl.org/Genome visualization and comparative genomics
    Enterobasehttps://enterobase.warwick.ac.uk/Large collection of E. fergusonii assemblies
    PATRIChttps://www.patricbrc.org/Pathogen resource with genomic and protein data
  • Specialized Bioenergetics Resources:

    ResourceDescriptionApplication to RnfE Research
    BRENDAEnzyme information databaseBiochemical parameters of Rnf complex components
    BioEnergeticResourceDatabase of bioenergetic proteinsComparison of E. fergusonii RnfE with other bioenergetic systems
    Transporter Classification DBMembrane transport protein classificationClassification of RnfE within ion-translocating systems
    MetaCycMetabolic pathway databaseIntegration of Rnf function with metabolic networks
  • Experimental Protocols and Methods:

    Resource TypeExamplesRelevance to RnfE Research
    Protocol repositoriesProtocols.io, Nature ProtocolsMembrane protein purification, activity assays
    Method-specific journalsMethods in Enzymology, Current ProtocolsSpecialized techniques for electron transport proteins
    Open-source softwarePyMOL, GROMACS, HADDOCKTools for structural analysis and modeling
    Research resource identifiersRRID Portal (https://scicrunch.org/resources)Standard identifiers for antibodies, organisms, tools
  • RnfE-Specific Research Tools:

    ToolAvailabilityApplication
    AntibodiesCommercial (custom)Detection of E. fergusonii RnfE in samples
    Expression vectorsAddgeneRecombinant expression systems for RnfE
    E. fergusonii genetic toolsResearch laboratoriesGenetic manipulation of rnfE gene
    Purified recombinant RnfECommercial (e.g., Creative Biomart) Control protein for assays
  • Community Resources and Collaboration Platforms:

    PlatformURLValue for RnfE Research
    Research Gatehttps://www.researchgate.net/Connect with other RnfE researchers
    BioRxivhttps://www.biorxiv.org/Preprints on latest Rnf complex research
    GitHubhttps://github.com/Share computational tools for RnfE analysis
    Microbiome Data Integration PlatformVariousContext of E. fergusonii in microbiome studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.