Recombinant Escherichia fergusonii Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us for preferential development.
Synonyms
frdC; EFER_4206; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW
Uniprot No.

Target Background

Function
Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (anaerobic growth) and succinate dehydrogenase (aerobic growth). Fumarate reductase subunit C (FrdC) anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Fumarate reductase subunit C (frdC) in Escherichia fergusonii?

Fumarate reductase subunit C (frdC) in E. fergusonii appears to be primarily involved in the anchoring of the catalytic components of the fumarate reductase complex to the cytoplasmic membrane . This membrane anchoring function is critical for the proper positioning of the enzyme complex within the bacterial cell. The protein belongs to the FrdC family and consists of 131 amino acids with a molecular weight of approximately 15 kDa . The anchoring functionality enables the fumarate reductase complex to participate effectively in electron transport chains during anaerobic respiration, facilitating the reduction of fumarate to succinate.

How does fumarate reductase contribute to bacterial survival under anaerobic conditions?

Fumarate reductase is essential for bacterial survival under anaerobic conditions as it maintains redox balance by re-oxidizing intracellular FADH₂ or NADH when oxygen is deficient . This flavoprotein enzyme contains the cofactor flavin adenine dinucleotide (FAD) and is responsible for reducing fumarate to succinate, which serves as a terminal electron acceptor in the absence of oxygen . The process allows bacteria to continue generating energy through anaerobic respiration by providing an alternative pathway for electron flow.

Research has shown that soluble eukaryotic fumarate reductases can maintain an oxidizing environment under anaerobic conditions, either by oxidizing cellular flavin cofactors or through direct interaction with flavoenzymes . This mechanism is particularly important in microenvironments where oxygen availability fluctuates, allowing bacteria like E. fergusonii to adapt to changing conditions.

What is the amino acid sequence and structural characteristics of E. fergusonii frdC?

The E. fergusonii frdC protein consists of 131 amino acids with the following sequence:

MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGFVDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVATIVILFVALYW

This sequence is characteristic of a membrane-embedded protein, containing hydrophobic regions that facilitate its integration into the cytoplasmic membrane. The protein has a molecular mass of approximately 15 kDa, which is typical for membrane-anchoring subunits of larger enzyme complexes . The structural characteristics of frdC enable it to serve as an anchor for the catalytic components of the fumarate reductase complex, positioning them optimally for interaction with electron donors and the fumarate substrate.

How are E. fergusonii strains identified and characterized in laboratory settings?

Identification and characterization of E. fergusonii in laboratory settings involve a multi-step process:

  • Initial Isolation: Samples are suspended in buffered peptone water and incubated at 37°C for 18 hours .

  • Selective Media Culturing: The homogenates are streaked onto Simmons Citrate Agar plates supplemented with ribitol and incubated at 37°C for 36-48 hours. Presumptive E. fergusonii colonies appear yellow with orange sediment in the center due to fermentation of ribitol and D-arabinitol .

  • Differential Media Testing: A single typical colony is selected and streaked onto Sorbitol MacConkey Agar plates and incubated at 37°C for 24 hours. E. fergusonii produces colorless colonies as it cannot ferment sorbitol, unlike E. coli .

  • Molecular Confirmation: DNA extraction is performed using bacterial DNA extraction kits, followed by PCR amplification using specific primers (EF-F: 5′-AGATTCACGTAAGCTGTTACCTT-3′ and EF-R: 5′-CGTCTGATGAAAGATTTGGGAAG-3′) .

  • Genetic Relationship Analysis: Pulsed-field gel electrophoresis (PFGE) with XbaI restriction enzyme is performed to determine genetic relationships among isolates, with band matching analysis using optimization and tolerance settings of 1.0% and 1.5%, respectively .

What experimental approaches are most effective for studying fumarate reductase activity in recombinant strains?

Studying fumarate reductase activity in recombinant strains involves several sophisticated experimental approaches:

  • Two-Dimensional Gel Electrophoresis: This technique effectively separates and identifies both large and small subunits of fumarate reductase. Studies have shown that recombinant strains with amplified fumarate reductase expression show distinctive patterns in 2D gels, allowing for quantitative comparison of protein expression levels .

  • Quantitative Analysis of Subunit Expression: Dilution series and quantitative gel analysis can be used to construct standard curves for determining relative amounts of fumarate reductase subunits. Research has demonstrated that anaerobic recombinant strains can contain significantly higher levels of fumarate reductase (up to 36-fold amplification) compared to wild-type strains .

  • Metabolite Conversion Measurement: Tracking the conversion of fumarate to succinate under different conditions provides functional data on enzyme activity. Experimental data shows that glucose is required for this conversion, and in its absence, alternative products like malate may form .

  • Cell Density Optimization: Research indicates that fumarate reductase activity varies significantly with cell density. At low cell densities with anaerobic growth conditions, higher levels of succinate accumulate as fumarate reductase expression increases, while at high cell densities without growth, conversion rates may be lower due to enzyme repression .

How does oxygen availability affect the expression and activity of fumarate reductase in E. fergusonii?

Oxygen availability has profound effects on fumarate reductase expression and activity in bacteria like E. fergusonii:

  • Transcriptional Regulation: Quantitative RT-PCR analysis from chemostat cultures adapted to defined oxygen concentrations shows that genes involved in the reductive TCA cycle, including those encoding fumarate reductase, are upregulated under hypoxic conditions . This suggests that oxygen acts as a key environmental signal regulating fumarate reductase expression.

  • Enzyme Activity Patterns: Under aerobic conditions, fumarate reductase is typically repressed. When cells transition to anaerobic conditions, expression is induced, allowing for alternative electron transport pathways to be established . This regulation ensures efficient energy production regardless of oxygen availability.

  • Metabolic Pathway Shifts: As oxygen becomes limited, bacteria shift from the oxidative TCA cycle branch to the reductive branch. This is evidenced by the downregulation of enzymes like succinate dehydrogenase and upregulation of enzymes involved in the glyoxylate shunt and isocitrate metabolism .

  • Membrane Energization: Fumarate reductase activity contributes to maintaining an energized membrane in oxygen-limited conditions, suggesting its role extends beyond simple metabolic conversions to broader bioenergetic functions .

What are the methodological approaches for studying the membrane anchoring function of frdC?

Investigating the membrane anchoring function of frdC requires specialized methodologies:

  • Membrane Fractionation: Differential centrifugation techniques can separate membrane fractions containing the fumarate reductase complex. This allows researchers to quantify the distribution of fumarate reductase activity between soluble and membrane-bound fractions, providing insight into frdC's anchoring efficiency .

  • Site-Directed Mutagenesis: Creating specific mutations in the frdC sequence, particularly in hydrophobic regions presumed to be involved in membrane integration, can help identify critical residues for anchoring function. By expressing these mutant proteins and assessing their membrane localization, researchers can map the structural requirements for proper anchoring.

  • Fluorescence Microscopy with Tagged Constructs: Fusion of fluorescent proteins to frdC allows visualization of its subcellular localization. This approach can demonstrate whether the protein successfully integrates into the membrane and co-localizes with other fumarate reductase subunits.

  • Cross-linking Studies: Chemical cross-linking followed by mass spectrometry analysis can identify protein-protein interactions between frdC and other components of the fumarate reductase complex, as well as potential interactions with other membrane proteins or lipids that may stabilize its membrane anchoring function.

How do recombinant systems affect fumarate to succinate conversion efficiency?

Recombinant systems have significant impacts on fumarate to succinate conversion efficiency, as evidenced by comparative studies:

Table 1: Comparative Fumarate Reductase Expression and Activity in Different Strains

Strain TypeRelative Fumarate Reductase LevelEstimated Copies per CellConversion Efficiency
Wild-type (CA79)1× (baseline)1.2 × 10³Lower; produces malate as side product
Recombinant (JRG1233)~8×1.0 × 10⁴Intermediate
Recombinant (JRG1346)~36×4.5 × 10⁴Highest conversion rates

Research shows that recombinant strains with amplified fumarate reductase expression (containing approximately 1.2 to 5.4 μg of fumarate reductase per mg wet weight of cells) demonstrate significantly improved conversion of fumarate to succinate . The efficiency of this process is influenced by several factors:

  • Plasmid Copy Number: Higher plasmid copy numbers correlate with increased fumarate reductase expression. For example, strains with pBR322-based plasmids (copy number ~40) show higher expression than those with ColE1-based plasmids (copy number ~20) .

  • Growth Conditions: The conversion efficiency is significantly affected by whether cells are grown aerobically or anaerobically. Aerobically grown cells that are subsequently shifted to anaerobic conditions show initially lower conversion rates until fumarate reductase expression is induced .

  • Carbon Source Availability: Glucose is required for efficient fumarate to succinate conversion. In the absence of glucose, alternative metabolic pathways predominate, leading to the production of malate rather than succinate from fumarate .

What role does fumarate reductase play in maintaining redox balance in anaerobic environments?

Fumarate reductase plays a critical role in maintaining redox balance under anaerobic conditions through several mechanisms:

  • Alternative Electron Acceptor Utilization: In the absence of oxygen, fumarate serves as an alternative terminal electron acceptor. Fumarate reductase catalyzes the reduction of fumarate to succinate, enabling the reoxidation of reduced cofactors like FADH₂ or NADH that accumulate during anaerobic metabolism .

  • Maintenance of Oxidizing Environment: Research has demonstrated that soluble eukaryotic fumarate reductases can maintain an oxidizing environment under anaerobic conditions through two mechanisms: by oxidizing cellular flavin cofactors (FAD, FMN, and riboflavin) or through direct interaction with flavoenzymes .

  • Electron Transfer Specificity: Structural and enzymatic analyses indicate that fumarate reductase contains specific binding pockets for flavin molecules, allowing it to catalyze their oxidation while simultaneously reducing fumarate to succinate . This dual functionality enables the enzyme to serve as a metabolic hub connecting multiple redox processes.

  • Membrane Potential Preservation: Fumarate reductase activity contributes to maintaining an energized membrane in the absence of oxygen . This bioenergetic function is crucial for powering various cellular processes that rely on membrane potential, such as nutrient transport and protein secretion, even when aerobic respiration is not possible.

What are the optimal expression systems for producing recombinant E. fergusonii frdC?

When designing expression systems for recombinant E. fergusonii frdC production, several methodological considerations should be taken into account:

  • Vector Selection: Plasmid vectors with appropriate copy numbers are crucial for optimal expression. Research indicates that higher copy number vectors (such as pBR322 with approximately 40 copies per cell) yield significantly higher expression levels compared to lower copy number vectors (such as ColE1 with approximately 20 copies per cell) .

  • Host Strain Compatibility: The choice of host strain affects expression efficiency. Experimental data shows variable expression levels between different strains, with some demonstrating up to 36-fold amplification of fumarate reductase production .

  • Induction Conditions: Since fumarate reductase expression is naturally regulated by oxygen availability, expression systems can be designed to take advantage of this by incorporating oxygen-responsive promoters or using anaerobic induction methods to maximize protein production.

  • Membrane Integration Considerations: As frdC is a membrane-anchoring protein, expression systems must support proper membrane targeting and integration. This may require the co-expression of chaperones or specific membrane integration machinery depending on the host system used.

How can researchers effectively purify and characterize recombinant frdC protein?

Purification and characterization of recombinant frdC protein involves specialized techniques due to its membrane-associated nature:

  • Membrane Fraction Isolation: Initial purification steps should include careful isolation of membrane fractions through differential centrifugation, potentially using density gradient techniques to separate different membrane types.

  • Detergent Solubilization: Appropriate detergent selection is critical for solubilizing frdC from membranes while maintaining its native conformation. Mild non-ionic detergents like n-dodecyl β-D-maltoside are often suitable starting points.

  • Affinity Chromatography: Incorporation of affinity tags (such as His-tags) in recombinant constructs facilitates purification through immobilized metal affinity chromatography (IMAC).

  • Functional Characterization: Assessment of frdC function can be performed through:

    • Analysis of membrane integration using fluorescence techniques

    • Co-purification assays to identify interactions with other fumarate reductase subunits

    • Reconstitution experiments in liposomes to assess anchoring functionality

  • Structural Analysis: Methods such as circular dichroism spectroscopy can provide information about secondary structure content, while more advanced techniques like cryo-electron microscopy might be employed for detailed structural studies of the membrane-embedded protein.

What are the key challenges in studying E. fergusonii frdC compared to E. coli fumarate reductase?

Researchers face several distinct challenges when studying E. fergusonii frdC compared to the more extensively characterized E. coli fumarate reductase:

  • Genetic Tool Limitations: While E. coli has well-established genetic manipulation systems, equivalent tools for E. fergusonii may be less developed, complicating targeted genetic studies of frdC function.

  • Antimicrobial Resistance Considerations: E. fergusonii strains often harbor multiple antimicrobial resistance genes, with studies revealing 43 different AMR genes including extended spectrum beta-lactamase (ESBL) positive isolates in 51.88% of cases . This complicates experimental design and requires additional biosafety considerations.

  • Strain Diversity: E. fergusonii isolates demonstrate significant genetic diversity, with studies showing grouping into 41 PFGE subclades . This diversity means that findings from one strain may not be universally applicable, necessitating broader sampling approaches.

  • Differential Growth Requirements: Optimal culture conditions for studying fumarate reductase activity may differ between E. coli and E. fergusonii, requiring careful optimization of experimental parameters such as media composition, pH, and incubation conditions.

How can structural biology approaches enhance our understanding of frdC function?

Structural biology offers powerful approaches to deepen our understanding of frdC function:

  • Comparative Structural Analysis: While direct structural data for E. fergusonii frdC may be limited, comparing its sequence with structurally characterized homologs can provide insights into functional domains and critical residues.

  • Membrane Protein Crystallography: Advanced techniques in membrane protein crystallography, including lipidic cubic phase crystallization, could potentially resolve the structure of frdC in complex with other fumarate reductase subunits.

  • Cryo-Electron Microscopy: Single-particle cryo-EM approaches are increasingly successful for membrane protein complexes and could reveal how frdC interacts with other components of the fumarate reductase complex within the membrane environment.

  • Molecular Dynamics Simulations: Computational approaches can model how frdC integrates into lipid bilayers and how its structure may change in response to different membrane compositions or interactions with other proteins.

What emerging technologies might advance research on fumarate reductase functionality?

Several emerging technologies show promise for advancing fumarate reductase research:

  • CRISPR-Cas9 Genome Editing: Application of CRISPR-Cas9 technology to E. fergusonii could enable precise genetic manipulation of frdC and related genes, facilitating functional studies through targeted mutations or regulatory element modifications.

  • Single-Cell Analysis Techniques: Methods that can analyze gene expression or protein localization at the single-cell level could reveal population heterogeneity in fumarate reductase expression and activity under varying environmental conditions.

  • Advanced Imaging Approaches: Super-resolution microscopy techniques might allow visualization of fumarate reductase complex assembly and membrane distribution with unprecedented detail.

  • Nanodiscs and Synthetic Membrane Systems: These technologies provide controlled environments for studying membrane protein function, potentially allowing reconstitution of fumarate reductase complexes in defined lipid compositions to assess how membrane properties influence activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.