Recombinant Escherichia fergusonii Fumarate reductase subunit D (frdD)

What is the role of FrdD in the fumarate reductase complex of E. fergusonii?

FrdD functions as one of the two hydrophobic membrane anchor subunits in the fumarate reductase complex. According to structural studies, FrdD works alongside FrdC to anchor the catalytic FrdA and FrdB subunits to the inner surface of the cytoplasmic membrane. This membrane association is critical for the enzyme's ability to interact with quinones during anaerobic respiration .

Research shows that both FrdC and FrdD subunits are required for membrane association of fumarate reductase and for the oxidation of reduced quinone analogues. Experimental evidence demonstrates that separation of the DNA coding for the FrdC and FrdD proteins affects the ability of fumarate reductase to assemble into a functional complex .

What critical amino acid residues have been identified in E. fergusonii FrdD?

Several critical amino acid residues in FrdD have been identified through site-directed mutagenesis studies:

These residues appear to be components in an apolar QA-type site in the FRD complex . The established roles of such residues in the QA and QB sites of the photosynthetic reaction center suggests a similar structure operates in the fumarate reductase complex.

How does E. fergusonii FrdD compare to E. coli FrdD?

While E. fergusonii and E. coli are closely related species, E. fergusonii has evolved at an accelerated rate compared to E. coli . This evolutionary divergence may impact the structure and function of proteins including FrdD.

The complete amino acid sequence of E. fergusonii FrdD consists of 119 amino acids: "MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI" . Comparative analysis should be performed to identify specific differences between the species that might affect quinone binding or interaction with other subunits.

How can site-directed mutagenesis be optimized for studying E. fergusonii FrdD function?

When designing site-directed mutagenesis experiments for E. fergusonii FrdD:

• Target residues with known functional importance in E. coli (Phe-57, Gln-59, Ser-60, His-80) to confirm conservation of function

• Use multiple amino acid substitutions at each site to explore the physicochemical properties required

• Design mutations that vary in polarity, charge, and size to comprehensively assess functional requirements

For optimal results, include the following controls:

• Wild-type protein expression in parallel

• Inactive mutants as negative controls

• Assessment of proper membrane integration using fractionation studies

• Verification of intact complex formation with other Frd subunits

The study by Westenberg et al. demonstrated that replacement of specific residues in FrdD affected enzyme function differently, suggesting distinct roles in the quinone-binding pocket .

What approaches are most effective for studying the membrane topology of FrdD?

Effective approaches for studying E. fergusonii FrdD membrane topology include:

When applying these techniques to E. fergusonii FrdD, researchers should consider its hydrophobic nature and potential difficulties in maintaining native structure during isolation. Evidence suggests that the membrane-spanning regions of FrdD are critical for proper complex assembly and quinone interaction .

How can researchers optimize expression systems for recombinant E. fergusonii FrdD?

Optimizing expression of recombinant E. fergusonii FrdD requires addressing its hydrophobic nature:

• Expression vector selection:

  • Use vectors with tunable promoters to avoid toxic overexpression

  • Consider fusion tags that enhance solubility while minimizing functional interference

• Host strain selection:

  • C41(DE3) or C43(DE3) strains designed for membrane protein expression

  • Strains lacking endogenous fumarate reductase to prevent complementation

• Growth conditions:

  • Lower temperatures (16-20°C) to slow expression and improve folding

  • Anaerobic conditions to mimic native environment

  • Supplementation with heme precursors if required for assembly

• Protein extraction:

  • Mild detergents like DDM or LMNG for membrane extraction

  • Gentle solubilization to maintain subunit interactions

Research indicates that all four fumarate reductase subunits are necessary for proper complex assembly and function , suggesting co-expression strategies may be required for obtaining functional protein.

How should researchers interpret changes in enzymatic activity when specific residues in FrdD are mutated?

When interpreting site-directed mutagenesis data for E. fergusonii FrdD:

• Distinguish between effects on:

  • Complex assembly/stability

  • Membrane integration

  • Quinone binding

  • Electron transfer

• Employ multiple activity assays:

  • Menaquinol oxidase activity

  • Ubiquinone reductase activity

  • Benzyl viologen oxidase assay (FrdA/B activity independent of FrdC/D)

Research on E. coli FrdD showed that certain residues like FrdD Phe-57, Gln-59, and Ser-60 appear to be components in an apolar QA-type binding site . When interpreting E. fergusonii FrdD data, researchers should consider that:

• Mutations affecting complex assembly will impact all assays

• Mutations affecting only quinone interaction will show normal benzyl viologen activity but reduced quinone-dependent activity

• Different substitutions at the same position can provide insight into the physicochemical requirements of that position

How can researchers reconcile contradictory results in FrdD functional studies?

When facing contradictory results in E. fergusonii FrdD studies:

• Evaluate experimental differences:

  • Expression systems and conditions

  • Purification methods

  • Assay conditions (pH, temperature, buffer composition)

  • Detergent selection for membrane protein solubilization

• Consider genetic context:

  • Strain-specific differences in E. fergusonii isolates

  • Presence of suppressor mutations

  • Genetic background effects

• Systematically test variables:

  • Perform side-by-side comparisons under identical conditions

  • Use multiple complementary techniques to verify results

  • Isolate specific variables for controlled testing

Evidence suggests that E. fergusonii has evolved at an accelerated rate compared to E. coli , which may result in functional differences between orthologous proteins. Additionally, E. fergusonii demonstrates higher H2O2 resistance than E. coli , potentially indicating differences in respiratory enzymes that could affect experimental outcomes.

What experimental approaches are most effective for comparing FrdD function across Escherichia species?

For robust comparative analysis of FrdD across Escherichia species:

• Sequence-based approaches:

  • Multiple sequence alignment to identify conserved and variable regions

  • Phylogenetic analysis to understand evolutionary relationships

  • Identification of species-specific sequence signatures

• Functional comparison:

  • Heterologous expression in a common host lacking endogenous fumarate reductase

  • Standardized enzyme activity assays under identical conditions

  • Growth complementation studies under anaerobic conditions

• Structural analysis:

  • Homology modeling based on available structures

  • Comparative analysis of predicted membrane topology

  • Molecular dynamics simulations in membrane environments

Studies have shown that E. fergusonii has evolved at an accelerated rate compared to E. coli, with principal coordinate analysis of evolutionary rates showing two main groups: one including isolates of E. coli and clades CIII, CIV, and CV, and another including E. fergusonii, E. albertii, and clades CI and CII .

How can genomic analysis inform our understanding of E. fergusonii FrdD evolution?

Genomic analysis approaches for understanding E. fergusonii FrdD evolution:

• Whole genome comparative analysis:

  • Calculate average nucleotide identity (ANI) between Escherichia species

  • Construct maximum likelihood phylogenetic trees using core genes

  • Identify selective pressures through Ka/Ks ratio analysis

• Operon structure analysis:

  • Compare organization of the frd operon across species

  • Identify regulatory elements and their conservation

  • Examine genomic context for evidence of horizontal gene transfer

• Population genomics:

  • Analyze variability of FrdD across multiple E. fergusonii isolates

  • Identify potential signatures of adaptation in different environments

  • Correlate genetic variations with phenotypic differences

A multi-locus phylogenetic analysis that included E. fergusonii as an outgroup demonstrated clear evolutionary relationships within Escherichia species . Analysis of embedded antisense overlapping genes should also be considered, as these may affect the expression and function of proteins including FrdD .

What purification strategies work best for isolating functional recombinant E. fergusonii FrdD?

Effective purification strategies for E. fergusonii FrdD:

• Membrane preparation:

  • Gentle cell lysis (French press or sonication with cooling)

  • Differential centrifugation to isolate membrane fractions

  • Removal of peripheral proteins with chaotropic agents

• Detergent selection:

  • Screen multiple detergents (DDM, LMNG, Digitonin, GDN)

  • Use detergent-lipid mixed micelles to maintain native environment

  • Consider nanodiscs or SMALPs for membrane protein isolation

• Chromatography strategy:

  • Initial IMAC purification if using His-tagged constructs

  • Size exclusion chromatography to isolate intact complexes

  • Ion exchange chromatography for further purification

• Quality assessment:

  • Activity assays to confirm functional state

  • Mass spectrometry to verify protein integrity

  • Circular dichroism to assess secondary structure

Recombinant E. fergusonii FrdD has been successfully produced with glycerol in the storage buffer, suggesting the importance of stabilizing agents for this hydrophobic protein .

How can researchers overcome challenges in studying the interaction between FrdC and FrdD?

Strategies for studying FrdC-FrdD interactions:

• Co-expression approaches:

  • Dual expression vectors with compatible origins

  • Polycistronic constructs maintaining native gene arrangement

  • Inducible expression systems with balanced protein production

• Interaction analysis techniques:

  • Cross-linking mass spectrometry to identify contact points

  • FRET-based assays for monitoring protein proximity

  • Bimolecular fluorescence complementation for in vivo interaction studies

• Functional reconstitution:

  • Co-purification of interacting subunits

  • Reconstitution into liposomes or nanodiscs

  • Activity assays that depend on proper subunit interaction

Research on E. coli has shown that introducing the frdABC and frdD genes on separate plasmid vectors failed to restore anaerobic growth on glycerol and fumarate, suggesting that separation of the DNA coding for FrdC and FrdD affects the ability of fumarate reductase to assemble into a functional complex . This highlights the importance of maintaining the native arrangement of these genes when studying their interaction.

What are the best approaches for studying quinone binding sites in E. fergusonii FrdD?

Methodological approaches for quinone binding site analysis:

• Binding studies:

  • Isothermal titration calorimetry with quinone analogs

  • Surface plasmon resonance for binding kinetics

  • Fluorescence quenching studies with quinone derivatives

• Structural analysis:

  • Photo-affinity labeling with quinone analogs

  • Hydrogen-deuterium exchange mass spectrometry

  • Site-directed spin labeling EPR spectroscopy

• Computational approaches:

  • Molecular docking of quinone substrates

  • Molecular dynamics simulations of binding events

  • Quantum mechanical calculations for electron transfer parameters

Research on E. coli has identified specific residues in FrdD (Phe-57, Gln-59, Ser-60) as components in an apolar QA-type site . These residues likely serve as a starting point for investigating quinone binding in E. fergusonii FrdD. The established roles of such residues in the photosynthetic reaction center suggests a similar structure operates in the fumarate reductase complex.