Recombinant Escherichia fergusonii L-alanine exporter AlaE (alaE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will prepare according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which customers can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
alaE; EFER_0402; L-alanine exporter AlaE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
alaE
Target Protein Sequence
MESHTMLSAQSRWRNAMADTFAMVVYCTVVNMLIEIFLSGMSFEQSLSSRLVAIPVNILI ACPYGIYRDFFMRQARKMNNKGWTKTIADILAYVTFQSPVYAAILWVIGADWHQIVAAVS SNMVISMMMGAVYGYFLDYCRRLFKVTSYQQLKA
Uniprot No.

Target Background

Function
Exports L-alanine.
Database Links
Protein Families
AlaE exporter family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the L-alanine exporter AlaE and what is its primary function?

The L-alanine exporter AlaE is a membrane protein responsible for extruding excess L-alanine from bacterial cells. It serves as a critical regulatory mechanism for maintaining intracellular L-alanine homeostasis by functioning as a "safety valve" that prevents toxic accumulation of this amino acid within the cell . This function is particularly important in environments where bacteria might encounter high concentrations of L-alanine or alanine-containing peptides, such as the mammalian intestinal tract . The AlaE protein specifically transports L-alanine across the cellular membrane, with studies in E. coli demonstrating its L-alanine specificity compared to other amino acids . In E. fergusonii, AlaE likely performs a similar function as part of the amino acid homeostasis machinery, though species-specific differences in regulation and activity may exist.

How does E. fergusonii AlaE compare structurally to AlaE homologs in other bacterial species?

E. fergusonii AlaE belongs to a family of inner membrane proteins found primarily in enteric bacteria . Structural analysis suggests that E. fergusonii AlaE shares significant homology with its counterparts in related species, particularly E. coli, where the protein is designated as both alaE and ygaW . The E. fergusonii AlaE is classified as an inner membrane protein, suggesting it contains multiple transmembrane domains that anchor it within the cytoplasmic membrane . Sequence alignments of AlaE from various enteric bacteria, including E. fergusonii, E. coli, and Salmonella species, reveal conserved domains that are likely essential for transport function and substrate recognition . These similarities reflect the evolutionary conservation of amino acid export mechanisms among related bacterial species that inhabit similar ecological niches, particularly the mammalian intestinal environment.

What is known about the genetic regulation of AlaE expression in E. fergusonii?

While specific regulatory mechanisms for E. fergusonii AlaE have not been extensively characterized, insights can be drawn from studies of its E. coli homolog. In E. coli, AlaE expression is positively regulated by the global regulator Lrp (leucine responsive protein) in the presence of L-alanine and L-leucine, but not D-alanine . This regulatory mechanism likely represents an adaptive response to fluctuating amino acid availability in the intestinal environment. The expression pattern suggests that AlaE transcription increases when intracellular L-alanine levels rise, allowing cells to maintain appropriate cytoplasmic concentrations of this amino acid . Given the close phylogenetic relationship between E. fergusonii and E. coli, similar regulatory mechanisms likely control AlaE expression in E. fergusonii, though species-specific variations may exist in the sensitivity or magnitude of the response to different environmental signals.

How does E. fergusonii AlaE contribute to bacterial stress responses and survival?

E. fergusonii AlaE likely plays a critical role in bacterial stress tolerance, particularly in environments where L-alanine concentrations fluctuate significantly. Research with E. coli demonstrates that AlaE functions as an essential "safety valve" under high L-alanine conditions, with AlaE-deficient strains showing reduced competitive fitness when cocultured with wild-type strains in the presence of alanine-containing peptides . This survival advantage becomes particularly relevant in the intestinal environment, where alanine concentrations can reach approximately 1.9 mM in free form and 10.9 mM in peptide form . For E. fergusonii, which shares ecological niches with E. coli, AlaE likely provides similar protective functions against amino acid stress. Investigating the phenotypic consequences of AlaE deletion or overexpression in E. fergusonii under various stress conditions (oxidative, osmotic, pH) would reveal whether this exporter integrates into broader stress response networks beyond simple amino acid homeostasis.

What methodological approaches are most effective for characterizing L-alanine export activity in E. fergusonii?

Characterizing L-alanine export activity in E. fergusonii requires a multi-faceted approach combining genetic, biochemical, and physiological methods. A particularly effective experimental strategy involves creating an L-alanine non-metabolizing variant by deleting genes encoding aminotransferases and alanine racemases, similar to the approach used to identify AlaE in E. coli . This genetic background allows researchers to isolate export activity from metabolic interconversion of L-alanine. Transport assays using radiolabeled L-alanine can quantify export kinetics, while intracellular amino acid quantification through HPLC or LC-MS/MS provides complementary data on substrate accumulation. Competitive fitness assays, where wild-type and ΔalaE strains are cocultured in the presence of alanine-containing peptides, can demonstrate the physiological importance of the exporter . Membrane vesicle studies with purified recombinant AlaE can further characterize transport mechanism, energy coupling, and substrate specificity.

How can comparative genomics and evolutionary analysis inform our understanding of E. fergusonii AlaE function?

Comparative genomics approaches reveal that AlaE orthologs with high homology are present in a restricted group of bacterial species, primarily enteric bacteria . This limited distribution pattern suggests that AlaE evolved as a specialized adaptation to the intestinal environment, where fluctuations in amino acid availability necessitate efficient export mechanisms. Phylogenetic analysis of AlaE sequences across species can identify positively selected residues that may contribute to species-specific functional adaptations. For E. fergusonii AlaE, comparing sequence conservation with homologs from diverse enteric bacteria (including pathogenic and commensal strains) could reveal whether selective pressures vary across ecological niches or host ranges. Synteny analysis of the genomic region surrounding alaE in E. fergusonii and related species may uncover conserved gene neighborhoods or regulatory elements that provide additional context for understanding the functional integration of this exporter within cellular physiology.

What expression systems are optimal for producing recombinant E. fergusonii AlaE protein?

Multiple expression systems have been successfully employed for recombinant AlaE production, each with specific advantages depending on research objectives. For basic biochemical characterization, E. coli-based expression systems offer high yield and simplified purification protocols, with constructs typically achieving ≥85% purity as determined by SDS-PAGE . For structural studies requiring properly folded membrane proteins, cell-free expression systems may provide advantages by avoiding inclusion body formation common in overexpression of membrane proteins . When studying functional aspects that may depend on post-translational modifications, eukaryotic expression systems such as yeast or baculovirus-infected insect cells offer appropriate cellular machinery . For E. fergusonii AlaE specifically, consideration should be given to codon optimization based on the expression host, as well as the addition of affinity tags that minimize interference with protein folding and function. The choice between N-terminal versus C-terminal tags should be evaluated experimentally, as membrane topology may render one terminus more accessible than the other.

What are the critical controls needed when assessing AlaE function through genetic complementation studies?

Genetic complementation studies represent a powerful approach to validate AlaE function, particularly when comparing E. fergusonii AlaE with homologs from other species. Critical experimental controls must include: (1) Empty vector controls to account for vector-related effects; (2) Wild-type strain controls to establish baseline phenotypes; (3) AlaE-deficient strain controls to demonstrate the phenotypic defect being complemented; (4) Complementation with the native AlaE as a positive control; and (5) Complementation with a non-functional AlaE mutant as a negative control . When assessing growth in the presence of alanine-containing peptides like Ala-Ala (5 mM), which has been used successfully in E. coli studies, experiments should include both monoculture and coculture conditions to evaluate competitive fitness . Additionally, complementation studies should measure not only growth parameters but also intracellular and extracellular L-alanine levels to directly assess transport function.

How can structure-function relationships in E. fergusonii AlaE be investigated?

Investigating structure-function relationships in E. fergusonii AlaE requires a combination of computational prediction, targeted mutagenesis, and functional assays. Initial approaches should include transmembrane topology prediction to identify membrane-spanning regions, followed by sequence conservation analysis across homologs to identify potentially critical residues . Site-directed mutagenesis targeting conserved residues, particularly those in predicted transmembrane domains or substrate-binding regions, can generate variants for functional characterization. Key functional parameters to assess include: (1) Protein expression and membrane localization; (2) L-alanine export activity; (3) Substrate specificity; and (4) Regulatory responses to environmental signals. Cross-linking studies combined with mass spectrometry can identify potential interaction partners that may modulate AlaE function. For advanced structural characterization, techniques such as cryo-electron microscopy may be employed to resolve the three-dimensional structure of purified recombinant E. fergusonii AlaE, though membrane proteins present significant technical challenges for structural determination.

How does AlaE activity in E. fergusonii impact bacterial adaptation to the intestinal environment?

The intestinal environment presents bacteria with fluctuating nutrient availability, transitioning between "feast and famine" conditions that require robust homeostatic mechanisms . For E. fergusonii, AlaE likely plays a critical role in adapting to these changing conditions by preventing cytotoxic accumulation of L-alanine. The physiological relevance of AlaE becomes particularly apparent when considering the concentrations of alanine in the human intestine, which can reach approximately 1.9 mM in free form and 10.9 mM in peptide form . Studies in E. coli have demonstrated that AlaE provides a competitive advantage in coculture experiments when cells are exposed to alanine-containing dipeptides (Ala-Ala) . The regulatory network controlling AlaE expression, which involves the global regulator Lrp responding to L-alanine levels, further underscores the integration of this exporter into broader adaptive responses to the intestinal environment . For E. fergusonii, investigating AlaE function in the context of host-microbe interactions could reveal whether this transporter contributes to colonization efficiency or persistence during intestinal inflammation.

What is the relationship between AlaE activity and other cellular processes involved in amino acid homeostasis?

E. fergusonii AlaE functions within a broader network of cellular processes that collectively maintain amino acid homeostasis. In E. coli, intracellular L-alanine levels are determined by the balance between synthesis (via three aminotransferases: AvtA, YfbQ, and YfdZ), racemization (via alanine racemases Alr and DadX), catabolism (via D-amino acid dehydrogenase DadA), and transport across the membrane (via AlaE and importers) . The integration of these pathways creates a sophisticated regulatory network that responds to changing environmental conditions. The global regulator Lrp coordinates this response by simultaneously upregulating AlaE expression while repressing the LIV-I importer in the presence of L-alanine, thereby limiting import while enhancing export . This coordinated regulation prevents futile cycling of L-alanine across the membrane. For E. fergusonii, which likely possesses similar metabolic pathways, investigating the kinetic parameters of AlaE transport alongside the activities of biosynthetic and catabolic enzymes would provide insights into how these systems are balanced to maintain optimal intracellular L-alanine concentrations under different growth conditions.

How can the study of E. fergusonii AlaE inform our understanding of amino acid exporters in other bacterial species?

The study of E. fergusonii AlaE provides valuable insights into the broader field of bacterial amino acid export systems. Comparative analysis of AlaE with other amino acid exporters, such as the lysine-specific export system in Corynebacterium glutamicum, reveals common principles in the evolution of safety valve mechanisms across diverse bacterial lineages . The restricted distribution of AlaE orthologs, primarily in enteric bacteria, suggests that this exporter evolved as a specialized adaptation to the intestinal environment . Understanding the structure, function, and regulation of E. fergusonii AlaE can therefore provide a framework for investigating similar systems in other bacteria. Particularly relevant would be comparative studies examining whether the regulatory mechanisms controlling AlaE expression are conserved across species, or whether different environmental signals trigger exporter activity in bacteria adapted to different ecological niches. Such comparative approaches could reveal convergent or divergent evolutionary solutions to the common challenge of maintaining amino acid homeostasis under fluctuating environmental conditions.

What reporter systems can be utilized to monitor AlaE expression and activity in real-time?

Several reporter systems can be employed to monitor AlaE expression and activity in real-time, providing dynamic information about transporter regulation and function. For transcriptional analysis, fluorescent reporter fusions (such as alaE promoter-GFP) allow visualization of expression patterns in single cells and populations using flow cytometry or fluorescence microscopy . These systems can reveal heterogeneity in expression across bacterial populations and temporal dynamics in response to environmental signals like L-alanine or L-leucine . For monitoring protein levels and localization, translational fusions of AlaE with fluorescent proteins (ensuring the tag doesn't interfere with membrane insertion or function) can track subcellular distribution. To assess transport activity directly, intracellular L-alanine sensors based on FRET (Förster Resonance Energy Transfer) technology can detect changes in cytoplasmic amino acid concentrations. Additionally, pH-sensitive fluorescent proteins can monitor proton coupling during transport if AlaE utilizes proton gradients as an energy source. These approaches should be calibrated using strains with known alterations in AlaE expression or activity to establish the dynamic range and sensitivity of each reporter system.

What comparative approaches can reveal functional differences between AlaE homologs from E. fergusonii and other bacterial species?

Comparative functional analysis of AlaE homologs from E. fergusonii and other bacterial species can reveal evolutionary adaptations in amino acid export mechanisms. A systematic approach should begin with sequence alignment and phylogenetic analysis to identify conserved domains and species-specific variations . Heterologous expression studies, where AlaE variants from different species are expressed in a common genetic background (ideally an AlaE-deficient strain), allow direct comparison of functional parameters including: (1) Transport kinetics (Km and Vmax for L-alanine); (2) Substrate specificity profiles; (3) Regulatory responses to environmental signals; and (4) Contribution to stress tolerance and competitive fitness . Chimeric proteins, where domains from different AlaE homologs are exchanged, can identify regions responsible for species-specific functional differences. This approach is particularly valuable for understanding how evolutionary pressures in different ecological niches have shaped AlaE function. For E. fergusonii specifically, comparing its AlaE with homologs from both closely related species (E. coli) and more distant relatives can reveal whether functional differences correlate with phylogenetic distance or ecological adaptation.

Data Table: Comparative Analysis of AlaE Proteins from Selected Bacterial Species

SpeciesGene NamesProtein Size (aa)Key FeaturesExpression SystemPurification MethodRecommended Applications
E. fergusoniialaE, ygaW~150-200Inner membrane proteinE. coli, Cell-Free ExpressionSDS-PAGE (≥85% purity)Functional studies, antibody production
E. colialaE, ygaW, ECK2664, JW2645~150-200Alanine-inducible, stress-responsiveE. coli, Cell-Free ExpressionSDS-PAGE (≥85% purity)Structural studies, functional characterization
Salmonella arizonaealaE~150-200L-alanine exporterE. coliSDS-PAGE (≥85% purity)Comparative functional analysis
Vibrio choleraealaE, VC1828~150-200Hypothetical protein VC1828Cell-Free ExpressionSDS-PAGE (≥85% purity)Pathogen-specific adaptations
Rhodobacter sphaeroidesalaE, RSP_3651~150-200L-alanine exporterCell-Free ExpressionSDS-PAGE (≥85% purity)Non-enteric bacterial comparison
Yersinia pestisalaE~150-200MULTISPECIES: L-alanine exporterE. coliSDS-PAGE (≥85% purity)Pathogen-specific adaptations

This comparative analysis demonstrates the conservation of AlaE across various bacterial species, with expression systems optimized for different research applications . The consistent features across diverse species highlight the evolutionary conservation of this amino acid exporter, while species-specific variations may reflect adaptations to particular ecological niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.