Recombinant Escherichia fergusonii Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Escherichia fergusonii

Escherichia fergusonii is a Gram-negative, rod-shaped, facultatively anaerobic bacterium that does not form spores . It is generally motile due to peritrichous flagella, oxidase negative, and catalase positive . E. fergusonii is recognized as an emerging pathogen with zoonotic potential, causing various infections, including wound infections and hemolytic uremic syndrome (HUS) . It is also a reservoir of antimicrobial resistance (AMR) genes .

General Information of Large-Conductance Mechanosensitive Channel (MscL)

Mechanosensitive channels (MscL) are integral membrane proteins that respond to mechanical forces, such as changes in membrane tension . MscL channels are found in bacteria, archaea, and eukaryotes, playing a crucial role in protecting cells from hypoosmotic shock . When the cell membrane is stretched, these channels open, allowing ions and small molecules to flow across the membrane, thereby reducing the turgor pressure and preventing cell lysis .

Recombinant Escherichia fergusonii MscL

Recombinant Escherichia fergusonii Large-conductance mechanosensitive channel (MscL) refers to the MscL protein derived from E. fergusonii that has been produced using recombinant DNA technology . This involves isolating the gene encoding MscL from E. fergusonii, cloning it into a suitable expression vector, and then introducing this vector into a host organism (e.g., E. coli) for protein production . The recombinant protein can then be purified and used for various research purposes, such as studying its structure, function, and regulation .

Characteristics of Recombinant Escherichia fergusonii MscL

The recombinant Escherichia fergusonii MscL shares several key characteristics with other MscL homologs, while also possessing unique features specific to its E. fergusonii origin.

  • Sequence Information: The protein consists of 136 amino acids . The amino acid sequence is:

    MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEV LLTEIRDLLKEQNNRS

  • Structure: MscL proteins typically form homo-oligomeric complexes, with five or more subunits arranging to form a central pore through the membrane . The structure of E. fergusonii MscL is likely similar to other MscL structures, featuring transmembrane helices that rearrange upon membrane stretching to open the channel .

  • Function: The primary function of E. fergusonii MscL is to act as a safety valve, opening in response to increased membrane tension to prevent cell lysis . This is particularly important in fluctuating osmotic environments .

  • Antimicrobial Resistance: E. fergusonii strains, including those expressing MscL, can exhibit antimicrobial resistance (AMR) . The presence of AMR genes in E. fergusonii is a growing concern, as these genes can be transferred to other bacteria, potentially spreading resistance .

Applications and Research Findings

Recombinant Escherichia fergusonii MscL is a valuable tool in various research areas:

  • Structural Biology: Recombinant MscL can be used for structural studies, such as X-ray crystallography or cryo-electron microscopy, to determine the protein's three-dimensional structure and understand its gating mechanism .

  • Biophysics: The purified protein can be incorporated into artificial lipid bilayers to study its electrophysiological properties, such as conductance, ion selectivity, and response to different mechanical stimuli .

  • Drug Discovery: MscL is a potential target for developing new antimicrobial drugs . Inhibiting MscL function could compromise the ability of bacteria to respond to osmotic stress, making them more susceptible to antibiotics .

  • Material Science: MscL can be used in biosensors or bio-inspired materials that respond to mechanical stimuli .

Antimicrobial Resistance in E. fergusonii

Escherichia fergusonii is gaining attention due to its role as a reservoir of antimicrobial resistance (AMR) genes . Certain strains exhibit multidrug resistance, raising concerns about their potential impact on public health .

  • Mobile Genetic Elements: Avian and porcine strains of E. fergusonii have a higher number of antimicrobial resistance genes and mobile genetic elements, such as plasmids, transposons, and integrons .

  • Specific Resistance Genes:

    • Mobile colistin resistance (MCR) genes, which confer resistance to colistin .

    • Tigecycline resistance gene, tet(X4) .

    • Extended-spectrum beta-lactamase (ESBL) genes, including TEM, SHV, CTX-M, and OXA .

Tables

FeatureDescription
NameRecombinant Escherichia fergusonii Large-conductance mechanosensitive channel (MscL)
Source OrganismEscherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Protein Length136 amino acids
FunctionMechanosensitive channel; opens in response to membrane tension to prevent cell lysis
Potential ApplicationsStructural biology, biophysics, drug discovery, material science
Antimicrobial ResistanceCan harbor various AMR genes, including MCR, tet(X4), and ESBLs

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a useful guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
mscL; EFER_3274; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
mscL
Target Protein Sequence
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEV LLTEIRDLLKEQNNRS
Uniprot No.

Target Background

Function

A membrane channel activated by stretch forces in the lipid bilayer. It may play a role in regulating cellular osmotic pressure.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Escherichia fergusonii and why is its MscL channel of research interest?

Escherichia fergusonii is a Gram-negative bacterium closely related to E. coli that has emerged as an important organism in antimicrobial resistance research. E. fergusonii has been isolated from multiple sources including food animals (pigs, chickens, and ducks), farm soils, and clinical specimens . The large-conductance mechanosensitive channel (MscL) in E. fergusonii, like in other bacteria, plays a crucial role in osmotic regulation, functioning as a pressure-release valve to prevent cell lysis during hypoosmotic stress.

The research interest in E. fergusonii MscL stems from several factors. First, E. fergusonii has been increasingly recognized as an underrated reservoir for antimicrobial resistance genes, including mobile colistin resistance genes such as mcr-1 . Second, as a mechanosensitive channel with the largest known gated pore, MscL represents an excellent model system for studying mechanotransduction. Third, the structural and functional similarities between MscL channels across bacterial species make E. fergusonii MscL valuable for comparative studies of channel gating mechanisms and potential exploitation for antimicrobial development .

Methodologically, researchers studying E. fergusonii MscL typically begin with strain identification using methods such as matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF/MS) and 16S rRNA gene sequencing, followed by gene isolation and recombinant expression for further characterization .

How does the structure of MscL relate to its mechanosensitive function?

The MscL channel exhibits a unique structural architecture that directly enables its mechanosensitive function. MscL is composed of five identical subunits arranged around a central pore in a homopentameric structure (though E. fergusonii MscL stoichiometry should be specifically verified as some bacterial MscL channels like MscS have seven subunits) . Each subunit contains two transmembrane helices (TM1 and TM2) connected by a periplasmic loop, with cytoplasmic N- and C-terminal domains.

The functional mechanism relies on the following structural elements:

  • Transmembrane domains: The TM1 helices line the channel pore and contain the hydrophobic gate that prevents ion permeation in the closed state. TM2 helices face the membrane and detect tension changes.

  • Periplasmic loop: This region undergoes conformational changes during gating, as evidenced by EPR and FRET studies . Research using FRET has established a helix-tilt model for MscL gating .

  • Cytoplasmic domains: These regions form a "balloon" or "Japanese lantern" structure with openings around its equator in MscS, with similar features potentially present in E. fergusonii MscL .

Methodologically, researchers investigate structure-function relationships in MscL through:

  • X-ray crystallography to resolve atomic structures (primarily in closed states)

  • Electron paramagnetic resonance (EPR) to monitor conformational changes

  • Fluorescence resonance energy transfer (FRET) to measure distance changes during gating

  • Molecular dynamics simulations to model channel behavior under membrane tension

These approaches have revealed that MscL responds to membrane tension by undergoing substantial conformational changes, where the transmembrane helices tilt and the pore diameter increases from approximately 2 Å to over 25 Å when fully open, allowing passage of water, ions, and small solutes .

What are the optimal methods for recombinant expression of E. fergusonii MscL?

Recombinant expression of E. fergusonii MscL requires careful consideration of expression systems, vectors, and purification strategies. Based on established protocols for other bacterial MscL channels, the following methodological approach is recommended:

Expression System Selection:

  • E. coli expression systems: BL21(DE3) or similar strains are commonly used for membrane protein expression. When expressing E. fergusonii MscL, consider using an E. coli strain with all seven native mechanosensitive channels deleted (like MJF641) to prevent interference from endogenous channels .

  • Vector selection: pET series vectors with strong T7 promoters are effective for controlled expression. For E. fergusonii MscL, vectors containing fusion tags like His6 for purification or fluorescent proteins like sfGFP for expression monitoring have proven successful .

Expression Protocol:

  • Clone the E. fergusonii MscL gene into the expression vector, preferably with a C-terminal His6-tag for purification.

  • Transform the construct into the expression host.

  • Grow cultures at 37°C to mid-log phase (OD600 ~0.6).

  • Induce protein expression with IPTG (0.2-1.0 mM) and continue growth at a reduced temperature (18-25°C) for 3-6 hours or overnight to enhance proper folding.

  • Harvest cells by centrifugation and proceed to membrane preparation.

Optimization Considerations:

  • Modulate expression levels by adjusting the ribosome binding site (RBS) using recombineering approaches as demonstrated for other MscL proteins .

  • Co-expression with specific chaperones can enhance proper folding, as shown in the optimized expression of recombinant proteins in E. fergusonii .

  • For challenging expression cases, consider using a tetA-sacB gene fusion cassette for efficient integration and selection .

This methodological approach can be adjusted based on specific experimental goals and the properties of E. fergusonii MscL.

What purification strategies are most effective for obtaining functional recombinant E. fergusonii MscL?

Purifying functional E. fergusonii MscL requires specialized techniques to maintain the integrity of this membrane protein throughout the isolation process. The following purification methodology is recommended based on successful approaches with other bacterial mechanosensitive channels:

Membrane Preparation:

  • Resuspend cell pellets in buffer containing protease inhibitors.

  • Disrupt cells using sonication, French press, or cell disruptor.

  • Remove unbroken cells and debris by low-speed centrifugation (10,000 × g, 20 min).

  • Isolate membranes by ultracentrifugation (150,000 × g, 1 hour).

  • Wash membranes to remove peripheral proteins and resuspend in solubilization buffer.

Solubilization and Purification:

  • Solubilize membranes using appropriate detergents - typically n-dodecyl-β-D-maltopyranoside (DDM) at 1-2% for initial solubilization.

  • Remove insoluble material by ultracentrifugation (150,000 × g, 30 min).

  • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resin.

  • Include detergent at concentrations above CMC in all buffers.

  • Consider a second purification step using size exclusion chromatography to enhance purity.

Optimization Considerations:

  • Detergent screening is critical - while DDM is widely used, other detergents like LDAO or C12E8 may better preserve E. fergusonii MscL function.

  • Buffer optimization should include testing various pH values (typically pH 7-8), salt concentrations (150-500 mM NaCl), and stabilizing additives (glycerol, specific lipids).

  • For functional studies, reconstitution into liposomes or nanodiscs is recommended using methods like detergent dialysis or Bio-Beads removal.

Functionality Assessment:
After purification, functionality can be verified through:

  • Patch-clamp electrophysiology after reconstitution into liposomes or planar lipid bilayers

  • EPR spectroscopy to assess conformational integrity

  • Fluorescence-based assays to monitor channel activity

This systematic approach should yield pure, functional E. fergusonii MscL suitable for structural and functional studies.

What electrophysiological techniques are most suitable for characterizing E. fergusonii MscL function?

Electrophysiological characterization of E. fergusonii MscL requires specialized techniques to accurately measure channel activity in response to membrane tension. The following methodological approaches are recommended:

Patch-Clamp Electrophysiology:
Patch-clamp electrophysiology remains the gold standard for functional characterization of mechanosensitive channels. For E. fergusonii MscL, the following protocol is recommended:

  • Reconstitution system preparation:

    • Reconstitute purified MscL into azolectin liposomes (typically at protein:lipid ratio of 1:200-1:1000)

    • Form giant unilamellar vesicles (GUVs) through dehydration/rehydration cycles

  • Experimental setup:

    • Use borosilicate glass pipettes with resistances of 3-5 MΩ

    • Establish gigaohm seals on liposomes in inside-out or outside-out configuration

    • Apply negative pressure (suction) through the patch pipette using a pressure clamp apparatus

  • Data acquisition and analysis:

    • Record channel activity at different holding potentials (typically ±20 mV)

    • Measure current response to stepwise increases in negative pressure

    • Calculate open probability (Po) as a function of membrane tension

    • Determine the midpoint tension for activation (T1/2)

When analyzing patch-clamp data, it's important to note that membrane tension is not directly measured but calculated from the Laplace-Young equation:

σ = 2rΔP

where σ is membrane tension, r is patch curvature, and ΔP is the negative pressure . As an example, a negative pressure of 5 × 10³ Pa (0.05 atm) generates a tension of approximately 10 mN/m in a patch with 1 μm diameter .

Planar Lipid Bilayer Recordings:
For more controlled measurements, planar lipid bilayer systems offer an alternative approach:

  • Form bilayers across apertures in Teflon partitions

  • Incorporate purified MscL through direct addition or liposome fusion

  • Apply tension through hydrostatic pressure differences

This approach allows for more precise control of membrane composition and tension application.

How can researchers effectively measure the tension sensitivity and conductance properties of recombinant E. fergusonii MscL?

Detailed characterization of E. fergusonii MscL requires quantitative assessment of its tension sensitivity and conductance properties. The following methodological approach addresses these parameters:

Tension Sensitivity Characterization:

  • Quantitative pressure-response relationship:

    • Generate dose-response curves by plotting channel open probability (Po) against applied membrane tension (σ)

    • Fit data to the Boltzmann equation:
      Po = 1/[1 + exp(ΔG - σΔA)/kT]
      where ΔG is the energy difference between closed and open states in the absence of tension, ΔA is the in-plane protein expansion upon opening, k is Boltzmann's constant, and T is temperature .

  • Area expansion measurement:

    • Calculate ΔA from the slope of ln(Po/Pc) vs. tension plot

    • This parameter typically ranges from 10-20 nm² for bacterial MscL channels

  • Midpoint determination:

    • Identify T1/2 (tension at which Po = 0.5)

    • Compare with other characterized MscL channels (typically 10-12 mN/m)

Conductance Characterization:

  • Single-channel conductance:

    • Measure current amplitude at different voltages

    • Calculate conductance (typically ~3-3.5 nS for MscL channels)

    • Generate I-V relationships to assess linearity and rectification

  • Subconductance states:

    • Identify and characterize subconductance levels using amplitude histograms

    • Determine relative occupancy of each state as a function of tension

  • Ion selectivity:

    • Measure reversal potentials under asymmetric ion conditions

    • Calculate permeability ratios (PAnion/PCation) to determine selectivity

    • MscL typically shows slight anionic preference with PCl⁻/PK⁺ ≈ 1.5-2.0

Sample Data Table: Expected MscL Properties

ParameterTypical MscL ValueMeasurement Method
Single-channel conductance3.0-3.5 nSPatch-clamp at ±20 mV
Activation threshold8-10 mN/mPo vs. tension plot
T1/2 (midpoint)10-12 mN/mPo vs. tension plot
Area expansion (ΔA)10-20 nm²Slope of ln(Po/Pc) vs. tension
Ion selectivity (PCl⁻/PK⁺)1.5-2.0Reversal potential measurements
Water flux~4×10⁹ molecules/secMolecular dynamics simulation

For comprehensive characterization, researchers should compare these properties between E. fergusonii MscL and other well-characterized bacterial MscL channels to identify unique features that might relate to the specific ecological niche or antimicrobial resistance profile of E. fergusonii.

How can molecular dynamics simulations enhance our understanding of E. fergusonii MscL gating mechanisms?

Molecular dynamics (MD) simulations provide valuable insights into the dynamic behavior of MscL channels that cannot be directly observed with experimental techniques. For E. fergusonii MscL research, the following methodological approach is recommended:

Simulation Setup:

  • System preparation:

    • Create a homology model of E. fergusonii MscL based on available crystal structures (typically using Tb-MscL or Eco-MscL as templates)

    • Embed the channel in a lipid bilayer (POPC or POPE/POPG mixtures are commonly used)

    • Solvate the system with explicit water molecules and add ions to neutralize the system and achieve physiological concentration

    • The complete system typically contains 200,000-300,000 atoms

  • Simulation protocols:

    • Use both all-atom and coarse-grained approaches:

      • All-atom: For detailed interactions and short timescale events (10-100 ns)

      • Coarse-grained: For larger conformational changes over longer timescales (μs range)

    • Apply membrane tension through:

      • Surface tension coupling (anisotropic pressure control)

      • Lateral pressure application

      • Bilayer thinning

  • Integrating experimental data:

    • Incorporate distance restraints from EPR or FRET experiments

    • Apply limited tension values consistent with physiological conditions

    • Use ensemble approaches to sample conformational space more efficiently

Key Analysis Methods:

  • Structural transitions:

    • Monitor transmembrane helix tilting angles

    • Track pore radius changes using tools like HOLE

    • Identify kink formation (particularly around residues 39-41)

    • Measure periplasmic loop movements

  • Energetic analyses:

    • Calculate potential of mean force (PMF) for ion/water permeation

    • Determine energy barriers between conformational states

    • Assess lipid-protein interactions and their energetic contributions

  • Transport properties:

    • Quantify water and ion flux rates

    • MD simulations indicate that a single open MscL channel permits approximately 4×10⁹ water molecules per second

    • Calculate ion selectivity from simulation trajectories

Example Research Finding from MD Studies:
One significant insight from MD simulations of MscL channels is the identification of a periplasmic loop response to membrane thinning that appears to be independent of channel gating. Simulations in DMPC (a thinner membrane compared to POPC) showed increased activity in the periplasmic loop similar to that observed under tension, despite the absence of significant pore opening . This observation suggests a sensory role for the periplasmic domain that may precede full channel opening.

These simulation approaches, when combined with experimental validation, provide mechanistic insights into E. fergusonii MscL function that can inform antimicrobial development strategies targeting these essential channels.

What is the relationship between antimicrobial resistance mechanisms in E. fergusonii and MscL channel function?

The relationship between antimicrobial resistance (AMR) mechanisms in E. fergusonii and MscL channel function represents an emerging area of research with potential implications for novel antimicrobial development. This relationship can be explored through the following methodological approach:

Investigating Potential Interactions:

  • Correlation analysis:

    • Examine whether antimicrobial resistant E. fergusonii isolates show altered MscL expression or function

    • Compare MscL sequences from susceptible versus resistant isolates

    • Analyze whether membrane modifications associated with resistance affect MscL gating properties

  • Membrane properties assessment:

    • Characterize membrane fluidity and thickness in resistant versus susceptible strains

    • Measure membrane tension response to osmotic challenges

    • Evaluate lipid composition differences and their impact on MscL function

  • Combined resistance mechanisms:

    • Study interactions between MscL and efflux pumps, which are often upregulated in resistant strains

    • Investigate whether MscL plays a role in biofilm formation, which contributes to antimicrobial resistance

Experimental Approaches:

  • Gene expression correlation:

    • Perform transcriptomic analysis of clinical E. fergusonii isolates showing different resistance profiles

    • Assess whether stress conditions that induce antimicrobial resistance also affect MscL expression

    • Use qRT-PCR to quantify MscL expression in response to antimicrobial exposure

  • Functional studies:

    • Compare patch-clamp properties of MscL from resistant versus susceptible strains

    • Measure survival rates during osmotic downshock in strains with different resistance profiles

    • Assess whether MscL modulators affect antimicrobial susceptibility

Known Antimicrobial Resistance in E. fergusonii:
E. fergusonii is increasingly recognized as an underrated repository for antimicrobial resistance genes. Recent studies have shown high prevalence of resistance against multiple antibiotics:

AntibioticResistance Rate in E. fergusoniiReference
Sulfafurazole97.74%
Tetracycline94.74%
Ampicillin84.21%
Sulfamethoxazole83.46%
Colistin18.80%
Meropenem0%
Imipenem0%

Notably, E. fergusonii isolates have been found to carry the mcr-1 gene on plasmids, conferring resistance to colistin, a last-resort antibiotic . The presence of these resistance genes does not necessarily directly affect MscL function, but the membrane modifications that accompany some resistance mechanisms might indirectly influence mechanosensitive channel gating properties.

Potential Applications:
Understanding this relationship could lead to:

  • Development of MscL-targeting compounds that bypass or overcome existing resistance mechanisms

  • Creation of combination therapies that target both resistance pathways and MscL function

  • Design of diagnostic tools that use MscL function as a biomarker for specific resistance patterns

This research area represents an important frontier in addressing the global antimicrobial resistance crisis.

How can site-directed mutagenesis be used to investigate structure-function relationships in E. fergusonii MscL?

Site-directed mutagenesis offers a powerful approach to probe the structure-function relationships of E. fergusonii MscL by enabling researchers to make specific amino acid substitutions and assess their impact on channel properties. The following comprehensive methodology outlines this approach:

Strategic Mutation Design:

  • Target selection based on structural domains:

    • Transmembrane helices (TM1 and TM2): Focus on hydrophobic pore-lining residues in TM1 that form the gate and residues in TM2 that interact with the membrane

    • Periplasmic loop: Target residues involved in tension sensing and conformational changes

    • N-terminal and C-terminal domains: Examine residues involved in channel clustering or regulatory interactions

  • Mutation types:

    • Conservative substitutions: Preserve amino acid characteristics while introducing subtle changes (e.g., Val→Ile)

    • Charge alterations: Change electrostatic properties (e.g., Asp→Lys)

    • Hydrophobicity modifications: Alter membrane interaction (e.g., Leu→Asn)

    • Cysteine substitutions: Enable subsequent chemical modification or cross-linking studies

  • Functional hypotheses:

    • Design mutations predicted to affect specific aspects of channel function:

      • Gating threshold (tension sensitivity)

      • Conductance properties

      • Ion selectivity

      • Activation kinetics

Experimental Methods:

  • Mutagenesis techniques:

    • Overlap extension PCR: For introducing point mutations

    • Golden Gate assembly: For multiple mutations

    • Lambda Red recombineering: For chromosomal integration of mutations

  • Expression and functional analysis:

    • Express wild-type and mutant channels in MscL-null strains (e.g., MJF641)

    • Conduct osmotic downshock survival assays to assess basic functionality

    • Perform patch-clamp analysis to characterize electrophysiological properties

    • Use fluorescence-based assays to monitor expression levels and localization

  • Structural confirmation:

    • Conduct EPR spectroscopy on spin-labeled mutants to confirm structural changes

    • Use FRET measurements to monitor distance changes during gating

    • Combine with computational modeling to interpret functional changes

Illustrative Results Table:

Mutation TypeExample in MscLExpected PhenotypeExperimental Approach
Hydrophobic gateV23T (TM1)Reduced gating thresholdPatch-clamp, survival assay
Tension sensorF78W (periplasmic loop)Altered tension responsePatch-clamp, EPR
Pore sizeG22W (TM1)Reduced conductanceSingle-channel recordings
Helix-helix interactionI96F (TM2)Altered gating kineticsPatch-clamp, EPR
Cross-linkingL13C (N-terminal)Constrained gatingPatch-clamp ± reducing agents

Case Study Application:
A particularly informative approach would be to study the periplasmic loop region of E. fergusonii MscL based on findings from MD simulations of MscL channels. Simulations have identified increased activity in this region in response to membrane thinning, independent of channel gating . Systematic mutagenesis of key residues in this region, followed by functional and structural analysis, could elucidate whether this domain serves as an independent tension sensor that precedes full channel opening. This could be accomplished by creating a series of mutations and measuring both periplasmic loop dynamics (via EPR or FRET) and channel gating parameters (via patch-clamp) to identify any decoupling between these processes.

This systematic mutagenesis approach would provide valuable insights into the structure-function relationships in E. fergusonii MscL and potentially reveal novel features specific to this bacterial species.

How can recombinant E. fergusonii MscL be utilized as a model system for drug discovery targeting bacterial mechanosensitive channels?

Recombinant E. fergusonii MscL offers significant potential as a model system for antimicrobial drug discovery, particularly given the increasing prevalence of multidrug resistance in this and related bacterial species. The following methodological framework outlines how to effectively utilize this system:

Development as a Drug Target Model:

  • Target validation approach:

    • Establish the essentiality of MscL under relevant stress conditions

    • Demonstrate that channel dysfunction leads to bacterial death during osmotic challenges

    • Verify that E. fergusonii MscL has sufficient structural differences from human mechanosensitive channels to enable selective targeting

  • High-throughput screening platform development:

    • Create fluorescence-based assays using liposomes containing MscL and fluorescent dyes

    • Develop patch-clamp automated systems for direct functional assessment

    • Implement computational screening approaches based on structural models

  • Rational drug design strategies:

    • Identify MscL features unique to E. fergusonii that can be selectively targeted

    • Focus on regions critical for gating but divergent from mammalian channels

    • Develop compounds that lock the channel in open state, causing cellular content leakage

Screening Methodologies:

  • Functional screening approaches:

    • Dye release assays: Reconstitute MscL in liposomes loaded with self-quenching fluorescent dyes; channel opening causes dye release and increased fluorescence

    • Patch-clamp screening: Test compounds for their ability to alter MscL gating properties

    • Bacterial survival assays: Assess whether compounds potentiate killing during osmotic stress

  • Binding assays:

    • Develop surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) methods to screen for direct binding

    • Create fluorescently labeled MscL variants for fluorescence anisotropy or FRET-based binding assays

    • Use thermal shift assays to identify compounds that alter protein stability

  • Structural approaches:

    • Utilize cryo-EM or X-ray crystallography to visualize compound binding

    • Apply hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify binding sites

    • Implement molecular dynamics simulations to predict binding modes and energetics

Drug Development Considerations:

  • Combination therapy potential:

    • Assess synergy between MscL modulators and conventional antibiotics

    • Investigate whether MscL modulators can enhance cellular uptake of existing antibiotics

    • Test whether co-targeting MscL and resistance mechanisms (e.g., efflux pumps) provides superior efficacy

  • Resistance prevention strategies:

    • Design multi-target compounds that simultaneously affect MscL and other essential functions

    • Develop modulator cocktails targeting different regions of the channel

    • Assess the frequency of resistance development against MscL-targeting compounds

The particular value of E. fergusonii MscL as a drug discovery target is enhanced by the fact that this bacterial species shows high levels of resistance to multiple antibiotics, including sulfafurazole (97.74%), tetracycline (94.74%), and ampicillin (84.21%) , while MscL represents a novel target mechanism that bypasses conventional resistance pathways.

What are the methodological approaches for engineering E. fergusonii MscL for biosensing and controlled release applications?

Engineering E. fergusonii MscL for biosensing and controlled release applications requires sophisticated protein engineering techniques combined with careful functional validation. The following methodological framework outlines key approaches:

Engineering Strategies:

  • Site-specific modification approaches:

    • Cysteine substitution: Introduce unique cysteines at strategic positions (particularly in the pore region) for chemical modification

    • Unnatural amino acid incorporation: Use amber suppression technology to incorporate photo-crosslinkable or clickable amino acids

    • Genetic fusion: Create chimeric channels with sensing domains from other proteins

  • Functional modifications:

    • Gating threshold engineering: Create channels that activate at lower membrane tensions

    • Ligand-dependent gating: Introduce binding sites for specific analytes

    • pH-sensitive variants: Modify channel to respond to specific pH changes

    • Light-activatable channels: Incorporate photoswitchable amino acids or domains

  • Delivery system integration:

    • Liposome reconstitution: Incorporate engineered channels into liposomes of defined composition

    • Polymerosome integration: Embed channels in artificial polymer-based vesicles

    • Cell-derived vesicle incorporation: Utilize bacterial outer membrane vesicles (OMVs) containing engineered MscL

Experimental Validation Methods:

  • Controlled release applications:

    • Dye release assays: Quantify release rates of fluorescent markers of different sizes

    • Therapeutic payload release: Measure release kinetics of model drugs or actual therapeutic compounds

    • Triggered release: Assess release in response to specific stimuli (osmotic pressure, pH, light, ligands)

  • Biosensing applications:

    • Electrical detection: Measure channel conductance changes in response to analytes

    • Optical readouts: Monitor fluorescence changes via FRET pairs or environmentally sensitive dyes

    • Electrochemical detection: Couple channel opening to electrochemical reactions

Practical Research Example:
A practical application would involve engineering E. fergusonii MscL to function as a biosensor for detecting antimicrobial compounds or environmental toxins. This could be achieved by:

  • Introducing cysteine residues at position 22 (in the pore constriction) for modification with specific chemical groups that respond to the target analyte

  • Reconstituting the modified channel into liposomes containing a self-quenching fluorescent dye

  • Developing a detection system where analyte binding induces channel opening, dye release, and fluorescence increase

This system could be tuned to detect various compounds relevant to environmental monitoring or clinical diagnostics.

Performance Metrics Table:

Engineering ApproachExample ModificationApplicationPerformance Metrics
Cysteine modificationG22C + charged MTS reagentsControlled drug releaseRelease rate, threshold tension, specificity
pH sensitivityD18N/D18H substitutionsTumor microenvironment sensingpH response range, activation kinetics
Ligand gatingFusion with ligand-binding domainBiosensing of specific analytesDetection limit, response time, selectivity
Photo-activationIncorporation of azobenzene linkersRemote-controlled releaseSwitching efficiency, light wavelength sensitivity
Tension threshold reductionMultiple hydrophilic substitutions in gateStimulus-responsive materialsActivation threshold, dynamic range

The unique properties of E. fergusonii MscL, combined with its relevance in antimicrobial resistance research, make it a particularly valuable candidate for these engineering applications, potentially enabling dual-purpose technologies that combine biosensing with targeted antimicrobial delivery.

How do single-molecule techniques advance our understanding of E. fergusonii MscL gating dynamics?

Single-molecule techniques provide unprecedented insights into MscL channel behavior by removing ensemble averaging effects and revealing heterogeneities in channel properties. For studying E. fergusonii MscL, the following methodological approaches are particularly valuable:

Advanced Single-Molecule Methods:

  • Single-molecule FRET (smFRET):

    • Implementation approach:

      • Introduce FRET pairs (donor/acceptor fluorophores) at strategic locations in the MscL protein

      • Use total internal reflection fluorescence (TIRF) microscopy to observe single channels reconstituted in supported lipid bilayers

      • Monitor real-time conformational changes during gating events

    • Analytical methods:

      • Time-resolved FRET efficiency measurements to capture transition states

      • Hidden Markov modeling to identify discrete conformational states

      • Dwell time analysis to determine kinetic parameters of state transitions

  • Single-channel patch-clamp with high temporal resolution:

    • Implementation approach:

      • Use low-noise recording equipment capable of sampling at >100 kHz

      • Apply precisely controlled pressure steps using high-speed pressure clamps

      • Record from patches containing few channels (ideally single channels)

    • Analytical methods:

      • Identify subconductance states using amplitude histograms

      • Analyze gating kinetics using idealization algorithms and dwell time distributions

      • Correlate pressure steps with conductance changes at millisecond resolution

  • Magnetic tweezers combined with electrophysiology:

    • Implementation approach:

      • Attach magnetic beads to specific domains of MscL channels

      • Apply defined forces while simultaneously recording channel activity

      • Directly correlate mechanical force with channel opening probability

    • Analytical methods:

      • Force-extension curves to identify mechanical transitions

      • Correlation analysis between applied force and channel conductance

      • Energy landscape reconstruction from force-dependent kinetic data

Research Insights and Applications:

Single-molecule techniques have revealed several key insights about MscL channels that would be applicable to E. fergusonii MscL research:

  • Heterogeneity in gating properties:

    • Individual channels can exhibit different tension thresholds and kinetic parameters

    • This heterogeneity may arise from variations in local membrane environment or post-translational modifications

    • Single-molecule approaches can quantify this variability and identify its molecular basis

  • Intermediate conformational states:

    • Multiple subconductance states exist between fully closed and fully open conformations

    • These states likely represent distinct structural conformations with functional significance

    • Single-molecule FRET can capture these intermediates even when they're too brief for electrophysiological detection

  • Cooperative gating behavior:

    • Interactions between MscL subunits and between neighboring channels affect gating dynamics

    • These interactions may be particularly important in understanding the response to gradual versus acute osmotic challenges

    • Single-molecule approaches can distinguish intrinsic channel properties from cooperative effects

By applying these advanced single-molecule techniques to E. fergusonii MscL, researchers can uncover unique aspects of this channel's behavior that may relate to the specific ecological niche and antimicrobial resistance profile of this bacterial species.

What emerging computational methods are advancing the study of E. fergusonii MscL and other bacterial mechanosensitive channels?

Computational methods are rapidly evolving to provide deeper insights into mechanosensitive channel function. For studying E. fergusonii MscL, the following cutting-edge computational approaches offer significant advantages:

Advanced Computational Methodologies:

  • Enhanced sampling molecular dynamics:

    • Metadynamics and umbrella sampling:

      • Apply bias potentials along reaction coordinates to overcome energy barriers

      • Calculate free energy profiles for channel opening/closing

      • Identify metastable intermediate states not accessible in conventional simulations

    • Replica exchange methods:

      • Run multiple simulations at different temperatures or with different biasing potentials

      • Allow exchanges between replicas to enhance conformational sampling

      • Construct detailed energy landscapes of the gating process

  • Machine learning augmented simulations:

    • Dimensionality reduction techniques:

      • Apply methods like principal component analysis (PCA) or t-SNE to identify essential motions

      • Identify collective variables that best describe the gating transition

      • Recognize patterns in simulation data that correlate with functional states

    • Neural network potentials:

      • Develop machine learning models trained on quantum mechanical calculations

      • Create more accurate force fields specifically optimized for MscL simulations

      • Enable longer simulations with quantum mechanical accuracy

  • Multi-scale modeling approaches:

    • Hybrid quantum mechanics/molecular mechanics (QM/MM):

      • Apply quantum mechanical calculations to critical regions (e.g., the gate)

      • Use classical mechanics for the remainder of the system

      • Capture electronic effects critical for understanding specific interactions

    • Coarse-grained to atomistic conversions:

      • Use coarse-grained simulations to sample large conformational changes

      • Convert selected frames to all-atom representations for detailed analysis

      • Bridge timescale gaps between experimental measurements and simulations

  • Integration with experimental data:

    • Bayesian inference approaches:

      • Incorporate experimental observables as constraints in simulations

      • Update model parameters based on experimental data

      • Generate ensembles of structures consistent with all available data

    • Simultaneous optimization of multiple experimental datasets:

      • Combine EPR, FRET, electrophysiology, and structural data

      • Resolve apparent contradictions between different experimental techniques

      • Create consensus models with higher confidence

Practical Applications for E. fergusonii MscL Research:

  • Resistance mechanism modeling:

    • Simulate the effects of membrane modifications associated with antimicrobial resistance on MscL function

    • Model how changes in membrane composition affect tension transmission to the channel

    • Predict compensatory mutations that might arise in MscL in response to membrane adaptations

  • Drug binding and effect prediction:

    • Perform virtual screening to identify potential MscL modulators

    • Simulate binding modes and energetics of candidate compounds

    • Predict functional effects of binding on channel gating

  • Evolutionary and comparative analysis:

    • Model structural and functional differences between E. fergusonii MscL and homologs from other species

    • Identify sequence variations that confer species-specific functional properties

    • Predict adaptations related to the specific environmental niche of E. fergusonii

Example Research Finding:
A significant insight from computational studies of MscL channels is that the periplasmic loop region responds to membrane thinning independently of channel gating. Simulations in DMPC (thinner membrane) showed increased periplasmic loop activity similar to that observed under tension, despite the absence of pore opening . This suggests a complex, multi-stage sensing mechanism that could be targeted in drug development. Advanced computational methods can extend this finding by predicting specific residues in E. fergusonii MscL that might serve as primary tension sensors versus those involved in the subsequent gating transition.

These computational approaches, when integrated with experimental validation, provide unprecedented insights into E. fergusonii MscL function that can inform antimicrobial development and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.