Escherichia fergusonii is a Gram-negative, rod-shaped, facultatively anaerobic bacterium that does not form spores . It is generally motile due to peritrichous flagella, oxidase negative, and catalase positive . E. fergusonii is recognized as an emerging pathogen with zoonotic potential, causing various infections, including wound infections and hemolytic uremic syndrome (HUS) . It is also a reservoir of antimicrobial resistance (AMR) genes .
Mechanosensitive channels (MscL) are integral membrane proteins that respond to mechanical forces, such as changes in membrane tension . MscL channels are found in bacteria, archaea, and eukaryotes, playing a crucial role in protecting cells from hypoosmotic shock . When the cell membrane is stretched, these channels open, allowing ions and small molecules to flow across the membrane, thereby reducing the turgor pressure and preventing cell lysis .
Recombinant Escherichia fergusonii Large-conductance mechanosensitive channel (MscL) refers to the MscL protein derived from E. fergusonii that has been produced using recombinant DNA technology . This involves isolating the gene encoding MscL from E. fergusonii, cloning it into a suitable expression vector, and then introducing this vector into a host organism (e.g., E. coli) for protein production . The recombinant protein can then be purified and used for various research purposes, such as studying its structure, function, and regulation .
The recombinant Escherichia fergusonii MscL shares several key characteristics with other MscL homologs, while also possessing unique features specific to its E. fergusonii origin.
Sequence Information: The protein consists of 136 amino acids . The amino acid sequence is:
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEV LLTEIRDLLKEQNNRS
Structure: MscL proteins typically form homo-oligomeric complexes, with five or more subunits arranging to form a central pore through the membrane . The structure of E. fergusonii MscL is likely similar to other MscL structures, featuring transmembrane helices that rearrange upon membrane stretching to open the channel .
Function: The primary function of E. fergusonii MscL is to act as a safety valve, opening in response to increased membrane tension to prevent cell lysis . This is particularly important in fluctuating osmotic environments .
Antimicrobial Resistance: E. fergusonii strains, including those expressing MscL, can exhibit antimicrobial resistance (AMR) . The presence of AMR genes in E. fergusonii is a growing concern, as these genes can be transferred to other bacteria, potentially spreading resistance .
Recombinant Escherichia fergusonii MscL is a valuable tool in various research areas:
Structural Biology: Recombinant MscL can be used for structural studies, such as X-ray crystallography or cryo-electron microscopy, to determine the protein's three-dimensional structure and understand its gating mechanism .
Biophysics: The purified protein can be incorporated into artificial lipid bilayers to study its electrophysiological properties, such as conductance, ion selectivity, and response to different mechanical stimuli .
Drug Discovery: MscL is a potential target for developing new antimicrobial drugs . Inhibiting MscL function could compromise the ability of bacteria to respond to osmotic stress, making them more susceptible to antibiotics .
Material Science: MscL can be used in biosensors or bio-inspired materials that respond to mechanical stimuli .
Escherichia fergusonii is gaining attention due to its role as a reservoir of antimicrobial resistance (AMR) genes . Certain strains exhibit multidrug resistance, raising concerns about their potential impact on public health .
Mobile Genetic Elements: Avian and porcine strains of E. fergusonii have a higher number of antimicrobial resistance genes and mobile genetic elements, such as plasmids, transposons, and integrons .
Specific Resistance Genes:
A membrane channel activated by stretch forces in the lipid bilayer. It may play a role in regulating cellular osmotic pressure.
KEGG: efe:EFER_3274
Escherichia fergusonii is a Gram-negative bacterium closely related to E. coli that has emerged as an important organism in antimicrobial resistance research. E. fergusonii has been isolated from multiple sources including food animals (pigs, chickens, and ducks), farm soils, and clinical specimens . The large-conductance mechanosensitive channel (MscL) in E. fergusonii, like in other bacteria, plays a crucial role in osmotic regulation, functioning as a pressure-release valve to prevent cell lysis during hypoosmotic stress.
The research interest in E. fergusonii MscL stems from several factors. First, E. fergusonii has been increasingly recognized as an underrated reservoir for antimicrobial resistance genes, including mobile colistin resistance genes such as mcr-1 . Second, as a mechanosensitive channel with the largest known gated pore, MscL represents an excellent model system for studying mechanotransduction. Third, the structural and functional similarities between MscL channels across bacterial species make E. fergusonii MscL valuable for comparative studies of channel gating mechanisms and potential exploitation for antimicrobial development .
Methodologically, researchers studying E. fergusonii MscL typically begin with strain identification using methods such as matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF/MS) and 16S rRNA gene sequencing, followed by gene isolation and recombinant expression for further characterization .
The MscL channel exhibits a unique structural architecture that directly enables its mechanosensitive function. MscL is composed of five identical subunits arranged around a central pore in a homopentameric structure (though E. fergusonii MscL stoichiometry should be specifically verified as some bacterial MscL channels like MscS have seven subunits) . Each subunit contains two transmembrane helices (TM1 and TM2) connected by a periplasmic loop, with cytoplasmic N- and C-terminal domains.
The functional mechanism relies on the following structural elements:
Transmembrane domains: The TM1 helices line the channel pore and contain the hydrophobic gate that prevents ion permeation in the closed state. TM2 helices face the membrane and detect tension changes.
Periplasmic loop: This region undergoes conformational changes during gating, as evidenced by EPR and FRET studies . Research using FRET has established a helix-tilt model for MscL gating .
Cytoplasmic domains: These regions form a "balloon" or "Japanese lantern" structure with openings around its equator in MscS, with similar features potentially present in E. fergusonii MscL .
Methodologically, researchers investigate structure-function relationships in MscL through:
X-ray crystallography to resolve atomic structures (primarily in closed states)
Electron paramagnetic resonance (EPR) to monitor conformational changes
Fluorescence resonance energy transfer (FRET) to measure distance changes during gating
Molecular dynamics simulations to model channel behavior under membrane tension
These approaches have revealed that MscL responds to membrane tension by undergoing substantial conformational changes, where the transmembrane helices tilt and the pore diameter increases from approximately 2 Å to over 25 Å when fully open, allowing passage of water, ions, and small solutes .
Recombinant expression of E. fergusonii MscL requires careful consideration of expression systems, vectors, and purification strategies. Based on established protocols for other bacterial MscL channels, the following methodological approach is recommended:
Expression System Selection:
E. coli expression systems: BL21(DE3) or similar strains are commonly used for membrane protein expression. When expressing E. fergusonii MscL, consider using an E. coli strain with all seven native mechanosensitive channels deleted (like MJF641) to prevent interference from endogenous channels .
Vector selection: pET series vectors with strong T7 promoters are effective for controlled expression. For E. fergusonii MscL, vectors containing fusion tags like His6 for purification or fluorescent proteins like sfGFP for expression monitoring have proven successful .
Expression Protocol:
Clone the E. fergusonii MscL gene into the expression vector, preferably with a C-terminal His6-tag for purification.
Transform the construct into the expression host.
Grow cultures at 37°C to mid-log phase (OD600 ~0.6).
Induce protein expression with IPTG (0.2-1.0 mM) and continue growth at a reduced temperature (18-25°C) for 3-6 hours or overnight to enhance proper folding.
Harvest cells by centrifugation and proceed to membrane preparation.
Optimization Considerations:
Modulate expression levels by adjusting the ribosome binding site (RBS) using recombineering approaches as demonstrated for other MscL proteins .
Co-expression with specific chaperones can enhance proper folding, as shown in the optimized expression of recombinant proteins in E. fergusonii .
For challenging expression cases, consider using a tetA-sacB gene fusion cassette for efficient integration and selection .
This methodological approach can be adjusted based on specific experimental goals and the properties of E. fergusonii MscL.
Purifying functional E. fergusonii MscL requires specialized techniques to maintain the integrity of this membrane protein throughout the isolation process. The following purification methodology is recommended based on successful approaches with other bacterial mechanosensitive channels:
Membrane Preparation:
Resuspend cell pellets in buffer containing protease inhibitors.
Disrupt cells using sonication, French press, or cell disruptor.
Remove unbroken cells and debris by low-speed centrifugation (10,000 × g, 20 min).
Isolate membranes by ultracentrifugation (150,000 × g, 1 hour).
Wash membranes to remove peripheral proteins and resuspend in solubilization buffer.
Solubilization and Purification:
Solubilize membranes using appropriate detergents - typically n-dodecyl-β-D-maltopyranoside (DDM) at 1-2% for initial solubilization.
Remove insoluble material by ultracentrifugation (150,000 × g, 30 min).
Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resin.
Include detergent at concentrations above CMC in all buffers.
Consider a second purification step using size exclusion chromatography to enhance purity.
Optimization Considerations:
Detergent screening is critical - while DDM is widely used, other detergents like LDAO or C12E8 may better preserve E. fergusonii MscL function.
Buffer optimization should include testing various pH values (typically pH 7-8), salt concentrations (150-500 mM NaCl), and stabilizing additives (glycerol, specific lipids).
For functional studies, reconstitution into liposomes or nanodiscs is recommended using methods like detergent dialysis or Bio-Beads removal.
Functionality Assessment:
After purification, functionality can be verified through:
Patch-clamp electrophysiology after reconstitution into liposomes or planar lipid bilayers
EPR spectroscopy to assess conformational integrity
Fluorescence-based assays to monitor channel activity
This systematic approach should yield pure, functional E. fergusonii MscL suitable for structural and functional studies.
Electrophysiological characterization of E. fergusonii MscL requires specialized techniques to accurately measure channel activity in response to membrane tension. The following methodological approaches are recommended:
Patch-Clamp Electrophysiology:
Patch-clamp electrophysiology remains the gold standard for functional characterization of mechanosensitive channels. For E. fergusonii MscL, the following protocol is recommended:
Reconstitution system preparation:
Reconstitute purified MscL into azolectin liposomes (typically at protein:lipid ratio of 1:200-1:1000)
Form giant unilamellar vesicles (GUVs) through dehydration/rehydration cycles
Experimental setup:
Use borosilicate glass pipettes with resistances of 3-5 MΩ
Establish gigaohm seals on liposomes in inside-out or outside-out configuration
Apply negative pressure (suction) through the patch pipette using a pressure clamp apparatus
Data acquisition and analysis:
Record channel activity at different holding potentials (typically ±20 mV)
Measure current response to stepwise increases in negative pressure
Calculate open probability (Po) as a function of membrane tension
Determine the midpoint tension for activation (T1/2)
When analyzing patch-clamp data, it's important to note that membrane tension is not directly measured but calculated from the Laplace-Young equation:
σ = 2rΔP
where σ is membrane tension, r is patch curvature, and ΔP is the negative pressure . As an example, a negative pressure of 5 × 10³ Pa (0.05 atm) generates a tension of approximately 10 mN/m in a patch with 1 μm diameter .
Planar Lipid Bilayer Recordings:
For more controlled measurements, planar lipid bilayer systems offer an alternative approach:
Form bilayers across apertures in Teflon partitions
Incorporate purified MscL through direct addition or liposome fusion
Apply tension through hydrostatic pressure differences
This approach allows for more precise control of membrane composition and tension application.
Detailed characterization of E. fergusonii MscL requires quantitative assessment of its tension sensitivity and conductance properties. The following methodological approach addresses these parameters:
Tension Sensitivity Characterization:
Quantitative pressure-response relationship:
Generate dose-response curves by plotting channel open probability (Po) against applied membrane tension (σ)
Fit data to the Boltzmann equation:
Po = 1/[1 + exp(ΔG - σΔA)/kT]
where ΔG is the energy difference between closed and open states in the absence of tension, ΔA is the in-plane protein expansion upon opening, k is Boltzmann's constant, and T is temperature .
Area expansion measurement:
Calculate ΔA from the slope of ln(Po/Pc) vs. tension plot
This parameter typically ranges from 10-20 nm² for bacterial MscL channels
Midpoint determination:
Identify T1/2 (tension at which Po = 0.5)
Compare with other characterized MscL channels (typically 10-12 mN/m)
Conductance Characterization:
Single-channel conductance:
Measure current amplitude at different voltages
Calculate conductance (typically ~3-3.5 nS for MscL channels)
Generate I-V relationships to assess linearity and rectification
Subconductance states:
Identify and characterize subconductance levels using amplitude histograms
Determine relative occupancy of each state as a function of tension
Ion selectivity:
Measure reversal potentials under asymmetric ion conditions
Calculate permeability ratios (PAnion/PCation) to determine selectivity
MscL typically shows slight anionic preference with PCl⁻/PK⁺ ≈ 1.5-2.0
For comprehensive characterization, researchers should compare these properties between E. fergusonii MscL and other well-characterized bacterial MscL channels to identify unique features that might relate to the specific ecological niche or antimicrobial resistance profile of E. fergusonii.
Molecular dynamics (MD) simulations provide valuable insights into the dynamic behavior of MscL channels that cannot be directly observed with experimental techniques. For E. fergusonii MscL research, the following methodological approach is recommended:
Simulation Setup:
System preparation:
Create a homology model of E. fergusonii MscL based on available crystal structures (typically using Tb-MscL or Eco-MscL as templates)
Embed the channel in a lipid bilayer (POPC or POPE/POPG mixtures are commonly used)
Solvate the system with explicit water molecules and add ions to neutralize the system and achieve physiological concentration
The complete system typically contains 200,000-300,000 atoms
Simulation protocols:
Use both all-atom and coarse-grained approaches:
Apply membrane tension through:
Surface tension coupling (anisotropic pressure control)
Lateral pressure application
Bilayer thinning
Integrating experimental data:
Incorporate distance restraints from EPR or FRET experiments
Apply limited tension values consistent with physiological conditions
Use ensemble approaches to sample conformational space more efficiently
Key Analysis Methods:
Structural transitions:
Energetic analyses:
Calculate potential of mean force (PMF) for ion/water permeation
Determine energy barriers between conformational states
Assess lipid-protein interactions and their energetic contributions
Transport properties:
Example Research Finding from MD Studies:
One significant insight from MD simulations of MscL channels is the identification of a periplasmic loop response to membrane thinning that appears to be independent of channel gating. Simulations in DMPC (a thinner membrane compared to POPC) showed increased activity in the periplasmic loop similar to that observed under tension, despite the absence of significant pore opening . This observation suggests a sensory role for the periplasmic domain that may precede full channel opening.
These simulation approaches, when combined with experimental validation, provide mechanistic insights into E. fergusonii MscL function that can inform antimicrobial development strategies targeting these essential channels.
The relationship between antimicrobial resistance (AMR) mechanisms in E. fergusonii and MscL channel function represents an emerging area of research with potential implications for novel antimicrobial development. This relationship can be explored through the following methodological approach:
Investigating Potential Interactions:
Correlation analysis:
Examine whether antimicrobial resistant E. fergusonii isolates show altered MscL expression or function
Compare MscL sequences from susceptible versus resistant isolates
Analyze whether membrane modifications associated with resistance affect MscL gating properties
Membrane properties assessment:
Characterize membrane fluidity and thickness in resistant versus susceptible strains
Measure membrane tension response to osmotic challenges
Evaluate lipid composition differences and their impact on MscL function
Combined resistance mechanisms:
Study interactions between MscL and efflux pumps, which are often upregulated in resistant strains
Investigate whether MscL plays a role in biofilm formation, which contributes to antimicrobial resistance
Experimental Approaches:
Gene expression correlation:
Perform transcriptomic analysis of clinical E. fergusonii isolates showing different resistance profiles
Assess whether stress conditions that induce antimicrobial resistance also affect MscL expression
Use qRT-PCR to quantify MscL expression in response to antimicrobial exposure
Functional studies:
Compare patch-clamp properties of MscL from resistant versus susceptible strains
Measure survival rates during osmotic downshock in strains with different resistance profiles
Assess whether MscL modulators affect antimicrobial susceptibility
Known Antimicrobial Resistance in E. fergusonii:
E. fergusonii is increasingly recognized as an underrated repository for antimicrobial resistance genes. Recent studies have shown high prevalence of resistance against multiple antibiotics:
| Antibiotic | Resistance Rate in E. fergusonii | Reference |
|---|---|---|
| Sulfafurazole | 97.74% | |
| Tetracycline | 94.74% | |
| Ampicillin | 84.21% | |
| Sulfamethoxazole | 83.46% | |
| Colistin | 18.80% | |
| Meropenem | 0% | |
| Imipenem | 0% |
Notably, E. fergusonii isolates have been found to carry the mcr-1 gene on plasmids, conferring resistance to colistin, a last-resort antibiotic . The presence of these resistance genes does not necessarily directly affect MscL function, but the membrane modifications that accompany some resistance mechanisms might indirectly influence mechanosensitive channel gating properties.
Potential Applications:
Understanding this relationship could lead to:
Development of MscL-targeting compounds that bypass or overcome existing resistance mechanisms
Creation of combination therapies that target both resistance pathways and MscL function
Design of diagnostic tools that use MscL function as a biomarker for specific resistance patterns
This research area represents an important frontier in addressing the global antimicrobial resistance crisis.
Site-directed mutagenesis offers a powerful approach to probe the structure-function relationships of E. fergusonii MscL by enabling researchers to make specific amino acid substitutions and assess their impact on channel properties. The following comprehensive methodology outlines this approach:
Strategic Mutation Design:
Target selection based on structural domains:
Transmembrane helices (TM1 and TM2): Focus on hydrophobic pore-lining residues in TM1 that form the gate and residues in TM2 that interact with the membrane
Periplasmic loop: Target residues involved in tension sensing and conformational changes
N-terminal and C-terminal domains: Examine residues involved in channel clustering or regulatory interactions
Mutation types:
Conservative substitutions: Preserve amino acid characteristics while introducing subtle changes (e.g., Val→Ile)
Charge alterations: Change electrostatic properties (e.g., Asp→Lys)
Hydrophobicity modifications: Alter membrane interaction (e.g., Leu→Asn)
Cysteine substitutions: Enable subsequent chemical modification or cross-linking studies
Functional hypotheses:
Design mutations predicted to affect specific aspects of channel function:
Gating threshold (tension sensitivity)
Conductance properties
Ion selectivity
Activation kinetics
Experimental Methods:
Mutagenesis techniques:
Expression and functional analysis:
Structural confirmation:
Conduct EPR spectroscopy on spin-labeled mutants to confirm structural changes
Use FRET measurements to monitor distance changes during gating
Combine with computational modeling to interpret functional changes
Illustrative Results Table:
| Mutation Type | Example in MscL | Expected Phenotype | Experimental Approach |
|---|---|---|---|
| Hydrophobic gate | V23T (TM1) | Reduced gating threshold | Patch-clamp, survival assay |
| Tension sensor | F78W (periplasmic loop) | Altered tension response | Patch-clamp, EPR |
| Pore size | G22W (TM1) | Reduced conductance | Single-channel recordings |
| Helix-helix interaction | I96F (TM2) | Altered gating kinetics | Patch-clamp, EPR |
| Cross-linking | L13C (N-terminal) | Constrained gating | Patch-clamp ± reducing agents |
Case Study Application:
A particularly informative approach would be to study the periplasmic loop region of E. fergusonii MscL based on findings from MD simulations of MscL channels. Simulations have identified increased activity in this region in response to membrane thinning, independent of channel gating . Systematic mutagenesis of key residues in this region, followed by functional and structural analysis, could elucidate whether this domain serves as an independent tension sensor that precedes full channel opening. This could be accomplished by creating a series of mutations and measuring both periplasmic loop dynamics (via EPR or FRET) and channel gating parameters (via patch-clamp) to identify any decoupling between these processes.
This systematic mutagenesis approach would provide valuable insights into the structure-function relationships in E. fergusonii MscL and potentially reveal novel features specific to this bacterial species.
Recombinant E. fergusonii MscL offers significant potential as a model system for antimicrobial drug discovery, particularly given the increasing prevalence of multidrug resistance in this and related bacterial species. The following methodological framework outlines how to effectively utilize this system:
Development as a Drug Target Model:
Target validation approach:
Establish the essentiality of MscL under relevant stress conditions
Demonstrate that channel dysfunction leads to bacterial death during osmotic challenges
Verify that E. fergusonii MscL has sufficient structural differences from human mechanosensitive channels to enable selective targeting
High-throughput screening platform development:
Create fluorescence-based assays using liposomes containing MscL and fluorescent dyes
Develop patch-clamp automated systems for direct functional assessment
Implement computational screening approaches based on structural models
Rational drug design strategies:
Identify MscL features unique to E. fergusonii that can be selectively targeted
Focus on regions critical for gating but divergent from mammalian channels
Develop compounds that lock the channel in open state, causing cellular content leakage
Screening Methodologies:
Functional screening approaches:
Dye release assays: Reconstitute MscL in liposomes loaded with self-quenching fluorescent dyes; channel opening causes dye release and increased fluorescence
Patch-clamp screening: Test compounds for their ability to alter MscL gating properties
Bacterial survival assays: Assess whether compounds potentiate killing during osmotic stress
Binding assays:
Develop surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) methods to screen for direct binding
Create fluorescently labeled MscL variants for fluorescence anisotropy or FRET-based binding assays
Use thermal shift assays to identify compounds that alter protein stability
Structural approaches:
Utilize cryo-EM or X-ray crystallography to visualize compound binding
Apply hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify binding sites
Implement molecular dynamics simulations to predict binding modes and energetics
Drug Development Considerations:
Combination therapy potential:
Assess synergy between MscL modulators and conventional antibiotics
Investigate whether MscL modulators can enhance cellular uptake of existing antibiotics
Test whether co-targeting MscL and resistance mechanisms (e.g., efflux pumps) provides superior efficacy
Resistance prevention strategies:
Design multi-target compounds that simultaneously affect MscL and other essential functions
Develop modulator cocktails targeting different regions of the channel
Assess the frequency of resistance development against MscL-targeting compounds
The particular value of E. fergusonii MscL as a drug discovery target is enhanced by the fact that this bacterial species shows high levels of resistance to multiple antibiotics, including sulfafurazole (97.74%), tetracycline (94.74%), and ampicillin (84.21%) , while MscL represents a novel target mechanism that bypasses conventional resistance pathways.
Engineering E. fergusonii MscL for biosensing and controlled release applications requires sophisticated protein engineering techniques combined with careful functional validation. The following methodological framework outlines key approaches:
Engineering Strategies:
Site-specific modification approaches:
Cysteine substitution: Introduce unique cysteines at strategic positions (particularly in the pore region) for chemical modification
Unnatural amino acid incorporation: Use amber suppression technology to incorporate photo-crosslinkable or clickable amino acids
Genetic fusion: Create chimeric channels with sensing domains from other proteins
Functional modifications:
Gating threshold engineering: Create channels that activate at lower membrane tensions
Ligand-dependent gating: Introduce binding sites for specific analytes
pH-sensitive variants: Modify channel to respond to specific pH changes
Light-activatable channels: Incorporate photoswitchable amino acids or domains
Delivery system integration:
Liposome reconstitution: Incorporate engineered channels into liposomes of defined composition
Polymerosome integration: Embed channels in artificial polymer-based vesicles
Cell-derived vesicle incorporation: Utilize bacterial outer membrane vesicles (OMVs) containing engineered MscL
Experimental Validation Methods:
Controlled release applications:
Dye release assays: Quantify release rates of fluorescent markers of different sizes
Therapeutic payload release: Measure release kinetics of model drugs or actual therapeutic compounds
Triggered release: Assess release in response to specific stimuli (osmotic pressure, pH, light, ligands)
Biosensing applications:
Electrical detection: Measure channel conductance changes in response to analytes
Optical readouts: Monitor fluorescence changes via FRET pairs or environmentally sensitive dyes
Electrochemical detection: Couple channel opening to electrochemical reactions
Practical Research Example:
A practical application would involve engineering E. fergusonii MscL to function as a biosensor for detecting antimicrobial compounds or environmental toxins. This could be achieved by:
Introducing cysteine residues at position 22 (in the pore constriction) for modification with specific chemical groups that respond to the target analyte
Reconstituting the modified channel into liposomes containing a self-quenching fluorescent dye
Developing a detection system where analyte binding induces channel opening, dye release, and fluorescence increase
This system could be tuned to detect various compounds relevant to environmental monitoring or clinical diagnostics.
Performance Metrics Table:
| Engineering Approach | Example Modification | Application | Performance Metrics |
|---|---|---|---|
| Cysteine modification | G22C + charged MTS reagents | Controlled drug release | Release rate, threshold tension, specificity |
| pH sensitivity | D18N/D18H substitutions | Tumor microenvironment sensing | pH response range, activation kinetics |
| Ligand gating | Fusion with ligand-binding domain | Biosensing of specific analytes | Detection limit, response time, selectivity |
| Photo-activation | Incorporation of azobenzene linkers | Remote-controlled release | Switching efficiency, light wavelength sensitivity |
| Tension threshold reduction | Multiple hydrophilic substitutions in gate | Stimulus-responsive materials | Activation threshold, dynamic range |
The unique properties of E. fergusonii MscL, combined with its relevance in antimicrobial resistance research, make it a particularly valuable candidate for these engineering applications, potentially enabling dual-purpose technologies that combine biosensing with targeted antimicrobial delivery.
Single-molecule techniques provide unprecedented insights into MscL channel behavior by removing ensemble averaging effects and revealing heterogeneities in channel properties. For studying E. fergusonii MscL, the following methodological approaches are particularly valuable:
Advanced Single-Molecule Methods:
Single-molecule FRET (smFRET):
Implementation approach:
Introduce FRET pairs (donor/acceptor fluorophores) at strategic locations in the MscL protein
Use total internal reflection fluorescence (TIRF) microscopy to observe single channels reconstituted in supported lipid bilayers
Monitor real-time conformational changes during gating events
Analytical methods:
Time-resolved FRET efficiency measurements to capture transition states
Hidden Markov modeling to identify discrete conformational states
Dwell time analysis to determine kinetic parameters of state transitions
Single-channel patch-clamp with high temporal resolution:
Implementation approach:
Use low-noise recording equipment capable of sampling at >100 kHz
Apply precisely controlled pressure steps using high-speed pressure clamps
Record from patches containing few channels (ideally single channels)
Analytical methods:
Identify subconductance states using amplitude histograms
Analyze gating kinetics using idealization algorithms and dwell time distributions
Correlate pressure steps with conductance changes at millisecond resolution
Magnetic tweezers combined with electrophysiology:
Implementation approach:
Attach magnetic beads to specific domains of MscL channels
Apply defined forces while simultaneously recording channel activity
Directly correlate mechanical force with channel opening probability
Analytical methods:
Force-extension curves to identify mechanical transitions
Correlation analysis between applied force and channel conductance
Energy landscape reconstruction from force-dependent kinetic data
Research Insights and Applications:
Single-molecule techniques have revealed several key insights about MscL channels that would be applicable to E. fergusonii MscL research:
Heterogeneity in gating properties:
Intermediate conformational states:
Multiple subconductance states exist between fully closed and fully open conformations
These states likely represent distinct structural conformations with functional significance
Single-molecule FRET can capture these intermediates even when they're too brief for electrophysiological detection
Cooperative gating behavior:
Interactions between MscL subunits and between neighboring channels affect gating dynamics
These interactions may be particularly important in understanding the response to gradual versus acute osmotic challenges
Single-molecule approaches can distinguish intrinsic channel properties from cooperative effects
By applying these advanced single-molecule techniques to E. fergusonii MscL, researchers can uncover unique aspects of this channel's behavior that may relate to the specific ecological niche and antimicrobial resistance profile of this bacterial species.
Computational methods are rapidly evolving to provide deeper insights into mechanosensitive channel function. For studying E. fergusonii MscL, the following cutting-edge computational approaches offer significant advantages:
Advanced Computational Methodologies:
Enhanced sampling molecular dynamics:
Metadynamics and umbrella sampling:
Apply bias potentials along reaction coordinates to overcome energy barriers
Calculate free energy profiles for channel opening/closing
Identify metastable intermediate states not accessible in conventional simulations
Replica exchange methods:
Run multiple simulations at different temperatures or with different biasing potentials
Allow exchanges between replicas to enhance conformational sampling
Construct detailed energy landscapes of the gating process
Machine learning augmented simulations:
Dimensionality reduction techniques:
Apply methods like principal component analysis (PCA) or t-SNE to identify essential motions
Identify collective variables that best describe the gating transition
Recognize patterns in simulation data that correlate with functional states
Neural network potentials:
Develop machine learning models trained on quantum mechanical calculations
Create more accurate force fields specifically optimized for MscL simulations
Enable longer simulations with quantum mechanical accuracy
Multi-scale modeling approaches:
Hybrid quantum mechanics/molecular mechanics (QM/MM):
Apply quantum mechanical calculations to critical regions (e.g., the gate)
Use classical mechanics for the remainder of the system
Capture electronic effects critical for understanding specific interactions
Coarse-grained to atomistic conversions:
Use coarse-grained simulations to sample large conformational changes
Convert selected frames to all-atom representations for detailed analysis
Bridge timescale gaps between experimental measurements and simulations
Integration with experimental data:
Bayesian inference approaches:
Incorporate experimental observables as constraints in simulations
Update model parameters based on experimental data
Generate ensembles of structures consistent with all available data
Simultaneous optimization of multiple experimental datasets:
Combine EPR, FRET, electrophysiology, and structural data
Resolve apparent contradictions between different experimental techniques
Create consensus models with higher confidence
Practical Applications for E. fergusonii MscL Research:
Resistance mechanism modeling:
Simulate the effects of membrane modifications associated with antimicrobial resistance on MscL function
Model how changes in membrane composition affect tension transmission to the channel
Predict compensatory mutations that might arise in MscL in response to membrane adaptations
Drug binding and effect prediction:
Perform virtual screening to identify potential MscL modulators
Simulate binding modes and energetics of candidate compounds
Predict functional effects of binding on channel gating
Evolutionary and comparative analysis:
Model structural and functional differences between E. fergusonii MscL and homologs from other species
Identify sequence variations that confer species-specific functional properties
Predict adaptations related to the specific environmental niche of E. fergusonii
Example Research Finding:
A significant insight from computational studies of MscL channels is that the periplasmic loop region responds to membrane thinning independently of channel gating. Simulations in DMPC (thinner membrane) showed increased periplasmic loop activity similar to that observed under tension, despite the absence of pore opening . This suggests a complex, multi-stage sensing mechanism that could be targeted in drug development. Advanced computational methods can extend this finding by predicting specific residues in E. fergusonii MscL that might serve as primary tension sensors versus those involved in the subsequent gating transition.
These computational approaches, when integrated with experimental validation, provide unprecedented insights into E. fergusonii MscL function that can inform antimicrobial development and biotechnological applications.