Recombinant Escherichia fergusonii Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for precise delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is defined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
yidC; EFER_4002; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-548
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
yidC
Target Protein Sequence
MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKL ISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGP DNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFILKRGDYAVNVNYNV QNAGEKPLEISTFGQLKQSITLPPYLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD NENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQT GAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPL GGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQK MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL HSREKKKS
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Facilitates folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of E. fergusonii YidC and how does it compare to YidC proteins in other bacteria?

E. fergusonii YidC is a membrane protein insertase that belongs to the YidC/Oxa1/Alb3 protein family, which is conserved across bacteria, archaea, and eukaryotic organelles. Structurally, the core of YidC consists of five transmembrane helices (TM2-TM6) that thread back and forth through the bacterial membrane. The protein also contains a non-conserved first transmembrane helix (TM1) and a periplasmic domain (P1) .

The transmembrane domains form a hydrophobic core that is critical for protein stability and function. Molecular dynamics simulations have shown that the YidC core is stabilized through both short and long-range interactions between the five helices. The cytoplasmic side contains primarily polar or charged residues engaged in electrostatic interactions, while the periplasmic side features primarily aromatic residues involved in stacking and nonpolar dispersion interactions .

When compared to YidC in other bacteria, E. fergusonii YidC shares significant sequence homology with E. coli YidC. The crystal structure of Bacillus halodurans YidC2 (BhYidC2), which has 34% sequence identity with E. coli YidC, provides insights into the general structural arrangement that would be expected in E. fergusonii YidC as well .

What is the primary function of YidC in E. fergusonii?

YidC in E. fergusonii functions as a membrane protein insertase, playing a crucial role in the insertion, folding, and assembly of newly synthesized membrane proteins. It operates both independently and in cooperation with the Sec translocon (SecYEG complex) to facilitate the proper insertion of various membrane proteins into the bacterial inner membrane .

The primary functions of YidC include:

  • Co-translational insertion of nascent membrane proteins directly from the ribosome

  • Post-translational insertion of certain membrane proteins

  • Assisting in the proper folding of membrane proteins into their three-dimensional structures

  • Acting as a chaperone to prevent misfolding and aggregation of membrane proteins

  • Cooperating with the SecYEG translocon to facilitate the insertion of more complex membrane proteins

In bacterial systems like E. fergusonii, YidC is essential for viability as it ensures proper respiratory metabolism by facilitating the insertion of critical respiratory chain components into the membrane .

What are the recommended methods for molecular identification of E. fergusonii YidC versus E. coli YidC?

Due to the high genetic similarity between E. fergusonii and E. coli, conventional identification methods like API 20E can misidentify E. fergusonii as E. coli (100% of isolates in one study) . For accurate molecular identification of E. fergusonii YidC, the following methodological approach is recommended:

  • Initial isolation and phenotypic identification:

    • Use standard enrichment, differential, and selective culture media

    • Perform preliminary biochemical tests

  • Molecular differentiation techniques:

    • Duplex PCR using specific primers: EFER 13- and EFER YP-specific primers have been shown to successfully identify E. fergusonii

    • Target genes for differentiation include:

      • Beta-glucuronidase enzyme gene

      • Conserved hypothetical cellulose synthase protein gene

      • Regulator of cellulose synthase gene

      • Putative transcriptional activator for multiple antibiotic resistance

  • Confirmation via sequencing:

    • Perform Sanger sequencing analysis of the amplified products

    • Compare sequences to reference databases

  • Whole genome sequencing:

    • For definitive identification, whole genome sequencing and comparative genomics can be used to distinguish between E. fergusonii and E. coli YidC

This multi-step approach ensures accurate identification of E. fergusonii YidC, overcoming the limitations of standard biochemical tests that frequently result in misidentification.

What expression systems are most effective for producing recombinant E. fergusonii YidC for structural and functional studies?

For effective production of recombinant E. fergusonii YidC, several expression systems have been optimized based on research with homologous YidC proteins:

  • Co-expression system:

    • A system allowing simultaneous expression of YidC and SecYEG has been established for E. coli YidC and would be applicable to E. fergusonii YidC

    • This approach is particularly valuable when studying YidC-SecYEG interactions, as it allows approximately stoichiometric YidC/SecYEG amounts required for efficient cross-linking studies

  • Inducible expression systems:

    • Anhydrotetracycline-inducible promoter systems have been successfully used for controlled overexpression of YidC in mycobacteria

    • These systems allow for precise regulation of expression levels, facilitating studies on the effects of YidC overexpression on bacterial physiology

  • Purification strategy:

    • Addition of a His-tag enables efficient purification via metal affinity chromatography

    • This approach has been successfully used to isolate YidC for in vitro reconstitution experiments and structural studies

  • Detergent selection:

    • For membrane protein purification, careful selection of detergents is critical

    • Mild detergents such as n-dodecyl β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are recommended to maintain the native conformation of YidC

When optimizing expression, it's important to note that overexpression of YidC can significantly alter bacterial growth and cell envelope integrity, as observed with M. tuberculosis YidC . Therefore, careful titration of expression levels is recommended for functional studies.

Which amino acid residues are critical for E. fergusonii YidC function based on mutagenesis studies?

Based on studies of homologous YidC proteins, several critical amino acid residues have been identified that are likely conserved in E. fergusonii YidC:

  • Transmembrane domain critical residues:

    • T362 in TM2 and Y517 in TM6 have been shown to be essential for YidC function in E. coli

    • Alanine mutations at these positions completely inactivated YidC without affecting protein stability

    • These residues are located at the same height in the membrane and likely form critical interactions for maintaining the functional conformation of YidC

  • Functionally important regions:

    • Several residues close to the T362-Y517 pair (F433, M471, and F505) show intermediate activity levels when mutated

    • Residues further away from this pair typically do not affect function when mutated

  • Interaction interface with nascent chains:

    • Residues in TM3, particularly M430C and P431C, have been shown to interact directly with inserting membrane proteins

    • Cysteine mutants at these positions can be crosslinked with nascent chains, confirming their role in substrate binding

  • Ribosome binding site:

    • Specific amino acids in the cytoplasmic domains interact with the ribosome, particularly at the nascent chain exit site

    • These residues are critical for co-translational insertion of membrane proteins

The hydrophobic core formed by the transmembrane helices is stabilized by both electrostatic interactions on the cytoplasmic side and aromatic stacking on the periplasmic side. These interactions are crucial for maintaining the structural integrity necessary for YidC function .

How does the hydrophobic region of YidC contribute to membrane protein insertion?

The hydrophobic region of YidC plays a multifaceted role in membrane protein insertion through several mechanisms:

The combination of these features allows YidC to act as both a protein channel and a chaperone, guiding nascent membrane proteins from the ribosome into the lipid bilayer while assisting in their proper folding.

How does E. fergusonii YidC interact with ribosomes during co-translational membrane protein insertion?

E. fergusonii YidC interacts with ribosomes during co-translational membrane protein insertion through a specific binding interface that facilitates the transfer of nascent membrane proteins directly from the ribosome exit tunnel to the membrane. Based on structural and functional studies of homologous YidC proteins:

  • Ribosome binding interface:

    • Cryo-electron microscopy studies have revealed that YidC binds to the ribosome near the nascent chain exit site

    • The binding occurs at the cytoplasmic portions of YidC that extend into the bacterial cell

    • This interaction positions YidC ideally to receive the emerging nascent chain

  • Nascent chain transfer pathway:

    • As the nascent membrane protein emerges from the ribosome, it enters a protected environment formed by YidC

    • The TM3 region of YidC has been identified through crosslinking experiments as a key interaction point with the nascent chain

    • This interaction guides the nascent chain toward the membrane insertion site

  • Sequential binding mechanism:

    • YidC first receives the nascent chain from the ribosome

    • The nascent chain is then guided through the hydrophilic cavity within YidC

    • Finally, the nascent chain is released laterally into the lipid bilayer through a controlled mechanism

  • Conformational changes:

    • The interaction with the ribosome likely induces conformational changes in YidC that facilitate nascent chain reception and insertion

    • These changes may expose the hydrophilic cavity and create a pathway for membrane insertion

This highly coordinated process ensures that hydrophobic membrane proteins are properly inserted into the lipid bilayer without misfolding or aggregation in the aqueous cellular environment.

What experimental approaches are most effective for studying YidC-ribosome nascent chain complexes?

Several cutting-edge experimental approaches have proven effective for studying YidC-ribosome nascent chain complexes:

The combination of these approaches provides a comprehensive understanding of how YidC interacts with ribosomes and nascent chains during membrane protein insertion.

How does YidC cooperate with the SecYEG translocon during membrane protein insertion in E. fergusonii?

YidC cooperates with the SecYEG translocon through a complex and dynamic interaction that facilitates the insertion of membrane proteins. This cooperation is essential for the insertion of certain membrane proteins that cannot be handled by either system alone:

  • Stoichiometry and abundance:

    • YidC is approximately 5 times more abundant than the SecYEG complex in bacterial cells

    • This abundance ratio suggests that YidC functions both independently and in conjunction with SecYEG

  • Interaction interface:

    • Cross-linking studies have demonstrated direct interaction between YidC and the SecYEG complex

    • When co-expressed at approximately stoichiometric levels, YidC and SecYEG form detectable cross-linked complexes

    • This interaction is specifically detected when both components are expressed at appropriate levels

  • Functional cooperation mechanisms:

    • Sequential handover: Some membrane proteins are initially engaged by the SecYEG translocon and subsequently transferred to YidC for final insertion and folding

    • Simultaneous processing: YidC and SecYEG may work together simultaneously on different segments of the same membrane protein

    • Complex formation: YidC may form part of a larger holotranslocon complex that includes SecYEG and other accessory factors

  • Substrate specificity:

    • Certain membrane proteins require both YidC and SecYEG for proper insertion

    • The cooperation between these systems expands the range of membrane proteins that can be efficiently inserted

This cooperative relationship between YidC and SecYEG represents a sophisticated mechanism that ensures efficient and accurate insertion of the diverse membrane proteome in bacteria like E. fergusonii.

What methods are most effective for studying the interaction between YidC and SecYEG?

Several specialized methods have been developed to study the challenging interaction between YidC and SecYEG:

  • Co-expression systems:

    • A key methodological advance is the development of co-expression systems that allow simultaneous expression of YidC and SecYEG

    • This approach overcomes limitations of standard expression systems where one component may be in excess

    • The co-expression creates approximately stoichiometric amounts of YidC and SecYEG, which is critical for detecting their interactions

  • In vivo crosslinking techniques:

    • Paraformaldehyde (PFA) treatment of cells co-expressing YidC and SecYEG

    • This approach preserves transient interactions that might be lost during purification

    • When YidC is purified via its His-tag after PFA treatment, a 95 kDa cross-link product containing SecY can be detected using antibodies

  • Site-specific crosslinking:

    • Incorporation of para-benzoyl-L-phenylalanine (pBpa) at specific positions in YidC

    • UV-induced crosslinking to identify interaction points with SecYEG components

    • This approach provides precise information about which domains of YidC contact the SecYEG translocon

  • Chemical crosslinking with DSS:

    • Using disuccinimidyl suberate (DSS) to stabilize protein-protein interactions

    • This approach identifies lysine residues that are in close proximity between YidC and SecYEG

  • Purification strategies:

    • His-tag purification of YidC followed by immunoblotting with antibodies against SecY

    • This technique confirms the specificity of interactions detected in crosslinking experiments

  • Functional assays:

    • Membrane protein insertion assays using substrates known to require both YidC and SecYEG

    • These assays provide evidence for functional cooperation between the two systems

When applying these methods, it's essential to maintain proper stoichiometry between YidC and SecYEG, as imbalances can significantly reduce the detection of interaction complexes.

How does the antimicrobial resistance profile of E. fergusonii impact research on recombinant YidC production?

The antimicrobial resistance profile of E. fergusonii presents specific challenges and considerations for researchers working with recombinant YidC:

  • Inherent resistance patterns:

    • E. fergusonii isolates have shown 100% resistance to penicillin G and 77% resistance to erythromycin

    • This resistance profile must be considered when selecting antibiotics for plasmid maintenance in expression systems

  • Selection marker strategy:

    • When designing expression vectors for E. fergusonii YidC, researchers must avoid selection markers that utilize antibiotics to which E. fergusonii is resistant

    • Alternative selection markers or antibiotics not affected by the resistance mechanisms of E. fergusonii should be employed

  • Contamination control:

    • The multidrug resistance of E. fergusonii complicates contamination control during prolonged cultivation

    • More stringent aseptic techniques and monitoring systems may be necessary

    • Researchers should implement contamination checks that can distinguish between the expression strain and potential contaminants

  • Host strain considerations:

    • When expressing E. fergusonii YidC in heterologous hosts (like laboratory E. coli strains), the antibiotic resistance genes should not be transferred

    • Careful vector design that separates resistance determinants from the yidC gene is recommended

  • Potential transfer of resistance:

    • The putative transcriptional activator for multiple antibiotic resistance found in E. fergusonii may influence expression systems

    • Researchers should monitor whether this regulatory element affects the expression of antibiotic resistance genes in the host

Understanding and accounting for these resistance patterns is crucial for developing effective expression strategies for recombinant E. fergusonii YidC production while maintaining proper laboratory biosafety practices.

What are the key differences in experimental approaches when working with YidC from slow-growing versus fast-growing bacterial species?

Research has revealed important differences in YidC proteins from slow-growing and fast-growing bacteria that necessitate distinct experimental approaches:

  • Expression system considerations:

    • Overexpression of YidC from slow-growing bacteria (like M. tuberculosis) has different physiological effects compared to YidC from fast-growing bacteria (like M. smegmatis)

    • Specifically, overexpression of M. tuberculosis YidC results in altered bacterial growth and compromised cell envelope integrity, while M. smegmatis YidC overexpression does not show these effects

    • This differential impact necessitates careful titration of expression levels for slow-growing bacterial YidC

  • Induction protocols:

    • For slow-growing bacteria YidC, induction conditions need to be optimized to minimize toxic effects

    • Anhydrotetracycline-inducible promoters with careful dose calibration have proven effective

    • For fast-growing bacteria YidC, standard induction protocols are generally suitable

  • Stress condition analysis:

    • YidC from slow-growing bacteria shows a distinct paradox in expression patterns under stress:

      • mRNA transcript levels are significantly repressed under cell surface stress conditions

      • Protein levels are moderately elevated under the same conditions

    • This disconnect requires monitoring both transcription and translation when studying YidC regulation

  • Purification strategies:

    • YidC from slow-growing bacteria may require specialized detergents or stabilizing agents during purification

    • The structural stability differences may necessitate modified buffer conditions

    • Temperature-sensitive steps may need adjustment based on the growth temperature optimum of the source organism

  • Functional assays:

    • YidC proteins from slow- and fast-growing bacteria are functionally distinct despite high sequence identity

    • This functional difference must be considered when designing activity assays or reconstitution experiments

    • Control experiments using YidC from both types of bacteria are recommended for comparative studies

These differences highlight the importance of organism-specific optimization when working with YidC proteins from different bacterial species, particularly when comparing slow-growing and fast-growing bacteria.

What are the most promising approaches for resolving contradictions in YidC expression data between mRNA and protein levels?

The paradoxical relationship between YidC mRNA transcript levels and protein levels presents an intriguing research challenge. Several promising approaches could help resolve this contradiction:

  • Integrative multi-omics approaches:

    • Simultaneous analysis of transcriptomics, proteomics, and potentially ribosome profiling

    • This comprehensive approach can identify disconnects between transcription, translation efficiency, and protein stability

    • Time-course experiments following stress induction would be particularly informative

  • Post-transcriptional regulation analysis:

    • Investigation of small RNAs that might regulate YidC mRNA stability or translation

    • Examination of RNA-binding proteins that could affect YidC mRNA fate

    • Analysis of 5' and 3' untranslated regions for regulatory elements

    • CLIP-seq (crosslinking immunoprecipitation-sequencing) to identify RNA-protein interactions affecting YidC expression

  • Protein stability and turnover studies:

    • Pulse-chase experiments to determine YidC protein half-life under different stress conditions

    • Identification of proteases or other factors that might regulate YidC protein levels

    • Proteasome inhibition studies to assess contribution of protein degradation pathways

  • Translational efficiency measurements:

    • Ribosome profiling to measure actual translation rates of YidC mRNA

    • Analysis of codon usage and potential rare codons that might affect translation efficiency

    • Investigation of translation initiation efficiency through reporter assays

  • Cell-specific expression analysis:

    • Single-cell transcriptomics and proteomics to assess cell-to-cell variation

    • This approach could reveal whether the observed paradox is a population-level phenomenon or occurs within individual cells

By applying these complementary approaches, researchers can develop a comprehensive understanding of the regulatory mechanisms controlling YidC expression at both the transcriptional and post-transcriptional levels. This will help resolve the observed contradictions between mRNA and protein levels under various stress conditions .

What are the critical next steps in understanding the structural dynamics of YidC during membrane protein insertion?

Understanding the structural dynamics of YidC during membrane protein insertion represents a frontier in membrane biology research. The following approaches are critical for advancing this field:

  • Time-resolved cryo-electron microscopy:

    • Capturing YidC in different states during the insertion process

    • Using techniques like time-resolved cryo-EM with microfluidic mixing

    • This approach could visualize conformational changes as YidC interacts with nascent chains

  • Single-molecule FRET studies:

    • Strategic placement of fluorophores on YidC to monitor conformational changes in real-time

    • Direct observation of YidC dynamics during interaction with ribosomes and nascent chains

    • This technique could reveal transient states not captured by static structural methods

  • Advanced molecular dynamics simulations:

    • Long-timescale simulations of YidC-mediated insertion using enhanced sampling techniques

    • Integration of experimental constraints from crosslinking and structural studies

    • These computational approaches can predict and visualize the insertion pathway

  • Hydrogen-deuterium exchange mass spectrometry:

    • Probing solvent accessibility changes in YidC during the insertion process

    • Identifying regions that undergo conformational changes upon substrate binding

    • This technique provides information about protein dynamics in solution

  • Structure-guided functional studies:

    • Systematic mutagenesis based on structural models to test hypotheses about the insertion mechanism

    • Combining mutations with biophysical measurements to validate proposed mechanisms

    • Focus on residues at the hypothesized insertion pathway and substrate binding sites

  • Integration with lipid research:

    • Investigation of how the local lipid environment affects YidC structure and function

    • Analysis of potential lipid-YidC interactions that facilitate membrane protein insertion

    • This direction acknowledges the critical role of the membrane environment in YidC function

Progress in these areas will provide a dynamic view of YidC function, moving beyond static structural snapshots to understand the complete cycle of membrane protein insertion. This knowledge will be essential for fully understanding membrane protein biogenesis and potentially developing interventions targeting this essential process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.