Recombinant Escherichia fergusonii NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
nuoK; EFER_0891; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Escherichia fergusonii and why is it significant for research?

Escherichia fergusonii is a Gram-negative, rod-shaped, facultatively anaerobic, non-spore-forming bacteria that are oxidase negative, catalase positive, and mostly motile due to peritrichous flagella. It is increasingly recognized as an emerging pathogen with significant zoonotic potential, capable of causing conditions ranging from wound infections to hemolytic uremic syndrome (HUS) . E. fergusonii has garnered scientific attention due to its role as a potential reservoir of antimicrobial resistance genes and its widespread presence in food animals, particularly in avian sources . Research on E. fergusonii contributes to our understanding of bacterial evolution, pathogenicity mechanisms, and antimicrobial resistance dissemination patterns.

What is the NADH-quinone oxidoreductase complex and what role does subunit K play?

NADH-quinone oxidoreductase (NDH-1 in bacteria, Complex I in mitochondria) is a large membrane protein complex that catalyzes the first step in the respiratory electron transport chain. This enzyme couples the transfer of electrons from NADH to quinone with the translocation of protons across the membrane, contributing to the generation of a proton motive force used for ATP synthesis.

The subunit K (nuoK) is homologous to the mitochondrial ND4L subunit and represents one of the smallest but functionally critical components of the complex. Research has shown that nuoK contains highly conserved membrane-embedded glutamic acid residues (particularly Glu-36 and Glu-72) that are essential for the coupling mechanism of NDH-1 . Mutations in these conserved residues result in significant impairment of coupled electron transfer activities and loss of electrochemical gradient generation, indicating their crucial role in the proton translocation pathway .

How can researchers differentiate between E. fergusonii and E. coli when studying recombinant proteins?

Methodological Answer:
Differentiating between E. fergusonii and E. coli requires a multi-faceted approach:

  • Molecular identification:

    • PCR amplification and sequencing of the 16S rRNA gene

    • Species-specific PCR targeting unique genomic regions

    • Whole genome sequencing for definitive identification

  • Biochemical differentiation:

    • E. fergusonii is typically positive for adonitol fermentation and negative for sucrose fermentation

    • Commercial biochemical test systems (API 20E, VITEK) with careful interpretation of results

  • Protein expression verification:

    • Design of species-specific primers that target sequence variations in the nuoK gene

    • Western blotting with antibodies that can distinguish between E. fergusonii and E. coli nuoK variants

    • Mass spectrometry analysis of expressed proteins to confirm species origin

When working with recombinant proteins, researchers should include appropriate controls and sequence verification steps to ensure the correct species origin of the protein under study.

What are optimal cloning strategies for expressing recombinant E. fergusonii nuoK?

Methodological Answer:
Successful cloning and expression of E. fergusonii nuoK requires careful consideration of several factors:

  • Vector selection:

    • pET vectors with T7 promoter systems for high-level expression

    • Vectors with fusion tags (His6, MBP, GST) positioned at the C-terminus to minimize interference with membrane insertion

    • Low-copy vectors for potentially toxic membrane proteins

  • Expression host optimization:

    • E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

    • Tunable expression systems (like PBAD or Tet-inducible) to control expression levels

    • Consider codon optimization if rare codons are present in the E. fergusonii nuoK sequence

  • Expression conditions:

    • Lower temperatures (16-25°C) to slow protein production and facilitate proper folding

    • Reduced inducer concentrations

    • Addition of membrane-stabilizing compounds (glycerol, specific detergents)

  • Extraction and purification protocol:

    • Gentle cell lysis methods to preserve membrane integrity

    • Carefully selected detergents (DDM, LMNG, or GDN) for solubilization

    • Purification under conditions that maintain the native protein conformation

This approach addresses the challenges inherent in membrane protein expression while maximizing yield and maintaining protein functionality.

How can site-directed mutagenesis be applied effectively to study functional residues in nuoK?

Methodological Answer:
Based on research findings regarding the nuoK subunit, a systematic approach to site-directed mutagenesis should include:

  • Target selection based on conservation analysis:

    • Focus on highly conserved glutamic acid residues, particularly Glu-36 and Glu-72 which have been shown to be crucial for coupling mechanisms

    • Target conserved arginine residues on cytosolic loops that may participate in proton translocation or subunit interactions

  • Mutation strategy:

    • Conservative substitutions (E→D or E→Q for glutamates; R→K or R→H for arginines) to distinguish between charge effects and structural requirements

    • Non-conservative substitutions to completely abolish function

    • Alanine-scanning mutagenesis to systematically evaluate the importance of specific residues

  • Validation methods:

    • In vitro assembly assays to confirm proper integration into the NDH-1 complex

    • Blue-native gel electrophoresis to verify complex formation

    • Activity assays measuring NADH oxidation coupled to proton translocation

    • Membrane potential measurements using fluorescent probes

  • Functional analysis:

    • Measure the impact on coupled electron transfer activities

    • Assess changes in electrochemical gradient generation

    • Compare the effects of single versus double mutations, particularly for charged residues in proximity

This systematic approach allows researchers to establish structure-function relationships and elucidate the mechanistic role of key residues in nuoK.

What methods are most effective for studying protein-protein interactions between nuoK and other NDH-1 subunits?

Methodological Answer:
Studying protein-protein interactions involving membrane proteins like nuoK requires specialized approaches:

  • Crosslinking methods:

    • Chemical crosslinking with bifunctional reagents of varying lengths

    • Photo-crosslinking with unnatural amino acids incorporated at specific positions

    • Mass spectrometry analysis of crosslinked products

  • Co-purification approaches:

    • Tandem affinity purification with tags on different subunits

    • Pull-down assays using antibodies against specific subunits

    • Blue-native PAGE to preserve native complex interactions

  • Biophysical techniques:

    • Förster resonance energy transfer (FRET) using fluorescently labeled subunits

    • Surface plasmon resonance (SPR) with immobilized nuoK or partner subunits

    • Isothermal titration calorimetry (ITC) for quantitative binding parameters

  • Computational and structural approaches:

    • Molecular docking simulations

    • Homology modeling based on available complex I structures

    • Molecular dynamics simulations to predict stable interaction interfaces

Researchers should employ multiple complementary methods to confirm interactions and establish a comprehensive interaction network within the NDH-1 complex.

How do mutations in conserved residues affect the function of nuoK in the NDH-1 complex?

Methodological Answer:
Studies on nuoK have revealed that specific conserved residues play crucial roles in the function of the NDH-1 complex:

  • Impact of glutamic acid mutations:

    • Mutations of the nearly perfectly conserved Glu-36 lead to almost complete loss of coupled electron transfer activities and inability to generate an electrochemical gradient

    • Mutations of the highly conserved Glu-72 result in significant diminution of coupled activities

    • These findings suggest that these membrane-embedded acidic residues are essential for the coupling mechanism of NDH-1

  • Effects of arginine mutations:

    • Severe impairment of coupled activities occurs when two vicinal arginine residues on a cytosolic loop are simultaneously mutated

    • This suggests these arginine residues may form part of a proton transfer pathway or stabilize interactions with other subunits

  • Functional consequences:

    • While assembly of the complex remains intact (as detected by blue-native gel electrophoresis), the electron transfer coupling is compromised

    • This indicates that these residues are specifically involved in the proton translocation mechanism rather than structural stability

  • Evolutionary significance:

    • The high conservation of these residues across species suggests their fundamental importance to the proton-pumping mechanism

    • Similar residues in homologous proteins (like ND4L in mitochondrial Complex I) likely serve comparable functions

These findings collectively support the hypothesis that specific charged residues in nuoK form part of the proton translocation pathway in the NDH-1 complex.

What techniques can accurately measure proton translocation mediated by recombinant nuoK?

Methodological Answer:
Measuring proton translocation activities of recombinant nuoK requires specialized techniques:

  • Reconstitution systems:

    • Purified recombinant nuoK must be reconstituted into proteoliposomes with other NDH-1 subunits

    • Careful lipid composition selection to mimic native membrane environment

    • Verification of correct orientation in the membrane is essential

  • Direct proton translocation measurements:

    • pH-sensitive fluorescent dyes (ACMA, pyranine) to monitor pH changes inside vesicles

    • pH electrode measurements in controlled buffer systems

    • Stopped-flow spectroscopy for rapid kinetic measurements

  • Membrane potential measurements:

    • Voltage-sensitive dyes (DiSC3(5), Oxonol VI) to monitor development of membrane potential

    • Patch-clamp techniques on giant proteoliposomes

    • Potassium/valinomycin systems to convert pH gradient to membrane potential

  • Coupled activity assays:

    • Simultaneous measurement of NADH oxidation (spectrophotometric) and proton translocation

    • Calculation of H+/e- stoichiometry

    • Comparison of wild-type versus mutant proteins to quantify coupling efficiency

These methodologies provide complementary information and should be used in combination to comprehensively characterize the proton translocation function of recombinant nuoK.

How does nuoK sequence variation in E. fergusonii correlate with antimicrobial resistance profiles?

Methodological Answer:
Investigating correlations between nuoK sequence variations and antimicrobial resistance (AMR) profiles requires a multi-dimensional approach:

  • Genome-wide association study (GWAS) approach:

    • Sequence nuoK genes from diverse E. fergusonii isolates with well-characterized AMR profiles

    • Identify single nucleotide polymorphisms (SNPs) or amino acid substitutions in nuoK

    • Use statistical methods to test for significant associations between specific variations and resistance phenotypes

  • Source-based comparative analysis:

    • E. fergusonii isolates from avian sources have been found to carry significantly higher numbers of antimicrobial resistance genes compared to isolates from other sources

    • Analyze whether nuoK sequence clusters correlate with source-specific AMR patterns

  • Respiratory chain efficiency analysis:

    • Test whether variations in nuoK affect NDH-1 efficiency and cellular energy production

    • Investigate if altered energy metabolism correlates with specific resistance mechanisms

  • Co-occurrence pattern analysis:

    • Examine if certain nuoK variants consistently co-occur with specific AMR genes or mobile genetic elements

    • Determine if there are genetic linkages between nuoK variants and AMR determinants

While current research shows that avian strains of E. fergusonii carry higher numbers of AMR genes and mobile genetic elements , direct correlations with nuoK variations would require dedicated studies focused on this specific relationship.

What phylogenetic insights can be gained from analyzing nuoK sequences across E. fergusonii strains?

Methodological Answer:
Phylogenetic analysis of nuoK sequences can provide valuable insights into E. fergusonii evolution and adaptation:

  • Sequence acquisition and alignment:

    • Obtain nuoK sequences from diverse E. fergusonii strains with comprehensive metadata

    • Perform multiple sequence alignment using algorithms optimized for membrane proteins

    • Identify conserved regions and variable domains

  • Tree construction and analysis:

    • Build phylogenetic trees using maximum likelihood, Bayesian, or neighbor-joining methods

    • Evaluate geographic clustering to identify regional evolutionary patterns

    • Assess host-specific adaptations by comparing strains from different animal sources

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify regions under positive or purifying selection

    • Identify potential adaptive mutations that may confer functional advantages

    • Compare selection patterns with those in related species

  • Comparative analysis with global E. fergusonii phylogeny:

    • Current research has shown that E. fergusonii isolates tend to cluster by isolation source and geographical location

    • Determine if nuoK-based trees recapitulate these patterns or provide different evolutionary signals

    • Assess whether nuoK evolution correlates with acquisition of virulence or AMR traits

What are the primary challenges in purifying recombinant nuoK and how can they be addressed?

Methodological Answer:
Purification of membrane proteins like nuoK presents several challenges:

  • Solubilization challenges:

    • Problem: Insufficient extraction from membranes

    • Solution: Systematic screening of detergents (DDM, LMNG, GDN) at different concentrations and temperatures

    • Alternative approach: Use of styrene-maleic acid copolymer (SMA) to extract proteins with their native lipid environment

  • Protein stability issues:

    • Problem: Rapid denaturation during purification

    • Solution: Addition of specific lipids (cardiolipin, phosphatidylglycerol) to stabilize the protein

    • Alternative approach: Nanodiscs or amphipols as detergent alternatives for maintaining stability

  • Low expression yields:

    • Problem: Toxic effects when overexpressing membrane proteins

    • Solution: Use of specialized expression strains (C41/C43) and tunable expression systems

    • Alternative approach: Cell-free protein synthesis systems optimized for membrane proteins

  • Purification protocol optimization:

    • Problem: Loss of structural integrity during purification

    • Solution: Gentle purification approaches using gradient elution

    • Alternative approach: On-column folding or reconstitution methods

  • Quality control considerations:

    • Problem: Heterogeneous protein preparations

    • Solution: Size exclusion chromatography and analytical ultracentrifugation to ensure homogeneity

    • Alternative approach: Fluorescence-detection size exclusion chromatography (FSEC) for rapid screening of conditions

These approaches systematically address the challenges inherent in membrane protein purification and can significantly improve the yield and quality of purified recombinant nuoK.

How can researchers verify the proper folding and assembly of recombinant nuoK in experimental systems?

Methodological Answer:
Verifying proper folding and assembly of recombinant nuoK requires multiple complementary approaches:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Fluorescence spectroscopy to monitor tertiary structure through intrinsic tryptophan fluorescence

    • Thermal shift assays to evaluate protein stability under different conditions

  • Functional verification:

    • Activity assays comparing wild-type and mutant variants

    • Complementation assays in nuoK knockout strains

    • Measurement of proton pumping activity in reconstituted systems

  • Structural integrity assessment:

    • Limited proteolysis to probe correctly folded domains

    • Blue-native gel electrophoresis to verify complex formation

    • Crosslinking experiments to confirm proper subunit interactions

  • Membrane integration analysis:

    • Protease protection assays to verify correct membrane topology

    • Fluorescence quenching experiments to determine accessibility of labeled residues

    • Immunodetection of epitope tags inserted at predicted loop regions

Verification MethodWhat It ConfirmsAdvantagesLimitations
Blue-native PAGEComplex assemblySimple technique, semi-quantitativeLimited structural detail
Activity assaysFunctional integrityDirect measure of biological functionRequires reconstitution system
CD spectroscopySecondary structureRapid assessment of foldingLimited information on tertiary structure
Proteolysis patternsDomain foldingSimple techniqueRequires optimization
ComplementationIn vivo functionalityPhysiologically relevantComplex to interpret

Research on nuoK has demonstrated that properly assembled complexes can be detected by blue-native gel electrophoresis and immunostaining, even when mutations affect the functional activity , highlighting the importance of combining structural and functional verification methods.

How might the study of E. fergusonii nuoK contribute to understanding antimicrobial resistance mechanisms?

Methodological Answer:
While not directly an antimicrobial target, studying nuoK in the context of E. fergusonii's emerging role as an AMR reservoir offers several research opportunities:

  • Energy metabolism and resistance:

    • Investigate how variations in respiratory chain efficiency (via nuoK) might affect the fitness cost of carrying AMR determinants

    • Explore potential interactions between respiratory chain function and efflux pump activity

    • Measure ATP production efficiency in strains with varying AMR profiles and nuoK variants

  • Co-evolution analysis:

    • Examine whether nuoK variants co-evolve with specific AMR genes

    • Assess if geographic or source-specific (avian, bovine, etc.) nuoK variants correlate with specific AMR patterns

    • Study whether strains from avian sources, which carry significantly higher numbers of AMR genes , show distinctive nuoK characteristics

  • Stress response connections:

    • Investigate the role of NDH-1 in bacterial stress responses that might influence antimicrobial susceptibility

    • Examine if specific nuoK variants alter bacterial persistence under antimicrobial pressure

    • Study potential connections between respiratory chain function and biofilm formation

  • Horizontal gene transfer considerations:

    • Assess whether mobile genetic elements carrying AMR genes also influence nuoK expression or function

    • Determine if energy metabolism changes mediated by nuoK variants affect conjugation efficiency

Given that avian strains of E. fergusonii have been identified as potential disseminators of antimicrobial resistance due to their higher carriage of mobile genetic elements and AMR genes , understanding the role of energy metabolism in this context could provide valuable insights into AMR spread dynamics.

What are the implications of E. fergusonii's zoonotic potential for studying conserved respiratory proteins like nuoK?

Methodological Answer:
The zoonotic potential of E. fergusonii creates unique research opportunities for studying respiratory chain proteins:

  • Host adaptation studies:

    • Compare nuoK sequences and functions across E. fergusonii strains from different hosts

    • Investigate whether host-specific metabolic environments drive adaptations in respiratory proteins

    • Determine if zoonotic transmission selects for specific nuoK variants

  • One Health approach integration:

    • Study nuoK in the context of bacterial adaptation across the animal-human interface

    • Examine whether nuoK function affects colonization capacity in different host species

    • Investigate potential correlations between respiratory efficiency and virulence in different hosts

  • Comparative analysis across Enterobacteriaceae:

    • Compare nuoK conservation patterns in zoonotic versus host-restricted bacterial species

    • Assess whether zoonotic potential correlates with specific respiratory chain adaptations

    • Evaluate if conserved respiratory functions contribute to broad host range capacity

  • Evolutionary pressure analysis:

    • Analyze selection pressures on nuoK in strains circulating between different host species

    • Determine if host jumps correlate with specific adaptive mutations in respiratory proteins

    • Investigate whether antibiotic pressure in food animals affects evolution of metabolic functions

This research direction aligns with findings that E. fergusonii has zoonotic significance and offers opportunities to understand how fundamental cellular processes like respiration may contribute to cross-species transmission potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.