Recombinant Escherichia fergusonii p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Escherichia fergusonii p-hydroxybenzoic acid efflux pump subunit AaeA (AaeA) is a protein component of an efflux pump found in Escherichia fergusonii that confers resistance to certain aromatic compounds . Efflux pumps are protein complexes that actively transport substances, including antibiotics and toxic compounds, out of the cell, thereby reducing their intracellular concentration . AaeA, along with AaeB, contributes to the efflux of aromatic carboxylic acids, playing a role in the organism's defense against these compounds .

Background and Discovery

The AaeAB efflux pump was initially identified in Escherichia coli through the upregulation of certain genes, including yhcP, in response to treatment with p-hydroxybenzoic acid (pHBA) . Subsequent research revealed that yhcP encodes a protein belonging to the putative efflux protein family . Further investigation of adjacent genes yhcQ and yhcR, along with the upstream gene yhcS, elucidated their roles in regulating the expression of yhcRQP . It was then proposed to rename yhcS, yhcR, yhcQ, and yhcP to aaeR, aaeX, aaeA, and aaeB, respectively, to reflect their function in aromatic carboxylic acid efflux .

Gene and Protein Information

The aaeA gene encodes the AaeA protein, which functions as a subunit of the AaeAB efflux pump . The aaeA gene is also known under the synonyms aas, EFER_2770, and Bifunctional protein Aas . The protein is 310 amino acids long .

Key characteristics of the aaeA gene and AaeA protein:

FeatureDescription
Gene NameaaeA
Synonymsaas; EFER_2770; Bifunctional protein Aas
Ordered Locus NamesEFER_3219
Protein Namesp-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein
SpeciesEscherichia fergusonii
Protein Length310 amino acids
UniProt IDB7LRL6

Function and Mechanism

AaeA is a component of the AaeAB efflux pump, which actively transports aromatic carboxylic acids out of the bacterial cell . This efflux mechanism helps the bacterium to tolerate and resist the toxic effects of these compounds . The AaeAB efflux system is highly regulated, suggesting that it plays a role as a "metabolic relief valve" to alleviate toxic effects of imbalanced metabolism .

Role in Antibiotic Resistance

While AaeA primarily functions in the efflux of aromatic carboxylic acids, efflux pumps, in general, are significant contributors to antibiotic resistance in bacteria . By expelling antibiotics from the cell, bacteria can reduce the intracellular concentration of these drugs, rendering them ineffective .

Recombinant AaeA

Recombinant AaeA is produced in E. coli using recombinant DNA technology . The recombinant protein is expressed with an N-terminal His tag for purification purposes . Recombinant AaeA can be used in various applications, including ELISA .

Applications in Research

Recombinant AaeA and its corresponding gene have several applications in scientific research:

  • Protein characterization: Studying the biochemical properties and structure of the AaeA protein to understand its function in the efflux pump complex .

  • Efflux pump studies: Investigating the substrate specificity, regulation, and mechanism of action of the AaeAB efflux pump .

  • Antimicrobial resistance research: Elucidating the role of efflux pumps, including AaeAB, in bacterial resistance to antibiotics and other antimicrobial agents .

  • Drug discovery: Identifying potential inhibitors of the AaeAB efflux pump to enhance the efficacy of antibiotics and other drugs .

Expression and Purification

Recombinant AaeA is typically produced in E. coli and purified using affinity chromatography based on the His tag . The purified protein is then used for downstream applications, such as structural studies, biochemical assays, and drug screening .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
aaeA; EFER_3219; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
aaeA
Target Protein Sequence
MKTLIRKLTRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITN VNVHDNQLVKKGQVLFTIDQPRYQKALAEAEADVAYYSVLAQEKRQEASRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNTFYVLAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSIAAGVTNASSTR DAKGMATIDSNLEWVRLAQRVPVRIRLDAQPENLWPAGTTATVVVTGKDDRDESQDSFFR KMAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is Escherichia fergusonii and why is it significant in microbiological research?

    Escherichia fergusonii is a Gram-negative, rod-shaped, facultatively anaerobic bacterium that is oxidase negative, catalase positive, and typically motile due to peritrichous flagella. It has emerged as a pathogen of increasing concern with zoonotic significance, causing conditions ranging from wound infections to hemolytic uremic syndrome (HUS) .

    The bacterium is taxonomically classified within the Enterobacteriaceae family and shares the lineage: Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia . Research significance stems from its increasing recognition as both a pathogen and a reservoir of antimicrobial resistance genes. The reference strain, E. fergusonii ATCC 35469, was originally isolated from human feces and has a fully sequenced genome consisting of a 4,588,711 bp circular chromosome and a 55,150 bp plasmid (pEFER) .

    Studies indicate that E. fergusonii strains from avian sources carry significantly higher numbers of antimicrobial resistance genes and mobile genetic elements compared to strains from other sources, making them potentially important vectors for the dissemination of antimicrobial resistance .

  • What is the biological function of the p-hydroxybenzoic acid efflux pump subunit AaeA in E. fergusonii?

    The p-hydroxybenzoic acid efflux pump subunit AaeA works in conjunction with AaeB to form a functional efflux pump system in E. fergusonii. This pump system operates as a metabolic relief valve, facilitating the elimination of specific compounds when they accumulate to high concentrations within the bacterial cell .

    The primary function appears to be the extrusion of potentially harmful aromatic compounds, particularly p-hydroxybenzoic acid derivatives, which may result from bacterial metabolism or environmental exposure. This efflux system likely contributes to bacterial homeostasis by preventing the toxic accumulation of these compounds, thereby enhancing bacterial survival under specific stress conditions.

    While direct experimental evidence specifically for E. fergusonii AaeA is limited in the available literature, its function can be inferred from homologous systems in related bacteria, where such efflux pumps play crucial roles in detoxification mechanisms and potentially contribute to intrinsic resistance against certain antimicrobial compounds.

  • How does the AaeA-AaeB efflux system fit into the broader context of bacterial efflux mechanisms?

    The AaeA-AaeB system represents one of several classes of efflux pumps found in gram-negative bacteria. These systems typically consist of multiple protein components that span the cell envelope (inner membrane, periplasm, and outer membrane) to facilitate the export of compounds directly to the external environment.

    Within the context of E. fergusonii and related Enterobacteriaceae, efflux pumps like AaeA-AaeB operate alongside other resistance mechanisms such as the AcrAB-TolC system, which has been reported in E. fergusonii genomes . While AcrAB-TolC is known to efflux a broad range of antibiotics, the AaeA-AaeB system appears more specialized for aromatic compounds.

    This specialization suggests a primary role in metabolic homeostasis rather than acquired antibiotic resistance, though the capacity to extrude toxic compounds may confer some level of intrinsic resistance to certain antimicrobials. Understanding the substrate specificity and regulation of the AaeA-AaeB system could provide insights into both bacterial physiology and potential resistance mechanisms.

Advanced Research Questions

  • What role might the AaeA efflux pump play in antimicrobial resistance of E. fergusonii?

    While the AaeA-AaeB efflux system primarily functions to extrude aromatic compounds, its activity may contribute to intrinsic resistance against certain antimicrobials, particularly those with aromatic structures. Efflux pumps have been widely recognized as contributors to antimicrobial resistance in various bacterial species.

    E. fergusonii has been documented to harbor multiple antimicrobial resistance determinants, including extended-spectrum beta-lactamases (ESBLs), carbapenemases, and mobilized colistin resistance (mcr) genes . Studies have shown that avian strains of E. fergusonii carry significantly higher numbers of antimicrobial resistance genes (p < 0.05) compared to strains from bovine and ovine origins .

    The relationship between AaeA-AaeB and these resistance determinants warrants investigation. Research questions might explore:

    1. Does overexpression of AaeA-AaeB confer resistance to specific antimicrobials?

    2. Is AaeA expression co-regulated with other resistance mechanisms under antimicrobial stress?

    3. Can AaeA-AaeB efflux clinically relevant antibiotics, and if so, which structural classes?

    Understanding these aspects could help elucidate the potential contribution of AaeA to the multidrug resistance phenotype observed in many E. fergusonii isolates.

  • How does the genomic context of the aaeA gene relate to horizontal gene transfer and antimicrobial resistance spread?

    E. fergusonii has been shown to possess numerous mobile genetic elements, including plasmids, transposons, and integrons, which facilitate horizontal gene transfer of antimicrobial resistance determinants . Analyzing the genomic context of the aaeA gene could provide insights into its evolutionary history and potential for mobilization.

    The complete genome sequence of E. fergusonii ATCC 35469 includes a chromosome of 4,588,711 bp and a plasmid (pEFER) of 55,150 bp . Determining whether aaeA is chromosomally encoded or plasmid-borne is crucial for understanding its stability within the genome and potential for horizontal transfer.

    Comparative genomic analyses have revealed that E. fergusonii isolates of avian origin demonstrate greater genomic diversity compared to those from other sources . This diversity, coupled with the higher prevalence of mobile genetic elements in avian strains, suggests that these isolates may be more prone to gene acquisition and loss, potentially including genes encoding efflux pump components.

    Research examining the genomic neighborhood of aaeA might reveal associations with insertion sequences, transposons, or other genetic mobility elements that could facilitate its transfer between bacterial strains or species.

  • What are the phylogenetic relationships between AaeA proteins across different bacterial species and what do they reveal about functional evolution?

    Phylogenetic analysis of AaeA proteins across bacterial species could provide valuable insights into the evolutionary history and functional diversification of this efflux pump component. E. fergusonii has been shown to cluster phylogenetically based on isolation source and geographical location .

    Research questions in this area might include:

    1. How conserved is AaeA among E. fergusonii strains from different sources (avian, bovine, human)?

    2. What is the degree of sequence similarity between E. fergusonii AaeA and homologs in related species like E. coli?

    3. Are there specific domains or motifs that are highly conserved, suggesting functional importance?

    4. Do phylogenetic patterns suggest instances of horizontal gene transfer versus vertical inheritance?

    A comparative analysis could be structured as follows:

    SpeciesAaeA LengthSequence Identity to E. fergusonii AaeASource Isolation
    E. fergusonii ATCC 35469310 aa100%Human fecal sample
    E. fergusonii (avian isolates)VariableVariablePoultry samples
    E. coliVariableVariableVarious
    Other EnterobacteriaceaeVariableVariableVarious

    Such analysis could reveal evolutionary patterns that might correlate with host adaptation or pathogenicity.

  • How does substrate specificity of the AaeA-AaeB efflux system compare with other efflux mechanisms in E. fergusonii?

    E. fergusonii possesses multiple efflux systems, including the AcrAB-TolC system that is known to transport various antibiotics . Understanding the substrate specificity of AaeA-AaeB compared to these other systems would provide insights into their complementary or redundant functions.

    While AaeA-AaeB appears specialized for p-hydroxybenzoic acid and related aromatic compounds, comprehensive substrate profiling using recombinant expression systems could reveal unexpected specificities. Research approaches might include:

    1. Heterologous expression of AaeA-AaeB in a susceptible host lacking endogenous efflux pumps

    2. Systematic testing of growth inhibition with various compounds in the presence versus absence of AaeA-AaeB

    3. Direct transport assays using radiolabeled or fluorescent substrates

    4. Structural modeling and docking studies to predict substrate binding

    The results could be organized in a substrate specificity profile:

    Compound ClassAaeA-AaeB ActivityAcrAB-TolC ActivityOther Efflux Systems
    p-Hydroxybenzoic acidsHighVariableVariable
    Beta-lactamsUnknownVariableVariable
    QuinolonesUnknownVariableVariable
    TetracyclinesUnknownVariableVariable
    Other aromatic compoundsUnknownVariableVariable

    Such comparative analysis would contribute to understanding the collective role of efflux systems in E. fergusonii physiology and antimicrobial resistance.

Methodological Considerations

  • What are the optimal conditions for expressing recombinant E. fergusonii AaeA protein?

    Expression of recombinant E. fergusonii AaeA protein requires careful optimization due to its nature as a membrane-associated protein. Based on available information, successful expression has been achieved in E. coli expression systems with the addition of an N-terminal His-tag for purification purposes .

    A methodological approach for optimizing expression might include:

    1. Vector selection: pET-based expression vectors under the control of the T7 promoter are commonly used for membrane proteins

    2. Host strain selection: E. coli strains such as BL21(DE3), C41(DE3), or C43(DE3) (the latter two specifically designed for membrane protein expression)

    3. Induction conditions:

      • IPTG concentration: 0.1-1.0 mM

      • Induction temperature: 16-30°C (lower temperatures often improve membrane protein folding)

      • Induction duration: 4-16 hours

    4. Media optimization:

      • Rich media (LB, TB, 2YT) for high biomass production

      • Defined media for controlled expression and isotopic labeling if structural studies are planned

    A typical expression protocol might involve:

    1. Transform expression plasmid into the selected E. coli strain

    2. Grow cultures to mid-log phase (OD600 of 0.6-0.8)

    3. Reduce temperature to 20°C

    4. Induce with 0.5 mM IPTG

    5. Continue expression for 16 hours

    6. Harvest cells by centrifugation

    7. Proceed with membrane preparation and protein purification

    This approach balances protein yield with proper folding, which is critical for functional studies.

  • What purification strategies are most effective for recombinant AaeA protein?

    Purification of membrane proteins like AaeA presents specific challenges due to their hydrophobic nature. A systematic purification strategy would typically include:

    1. Membrane extraction:

      • Cell lysis using mechanical methods (sonication, French press, homogenization)

      • Differential centrifugation to isolate membrane fractions

      • Solubilization with appropriate detergents (e.g., DDM, LDAO, OG)

    2. Affinity chromatography:

      • Immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag

      • Careful optimization of imidazole concentrations in wash and elution buffers

    3. Size exclusion chromatography:

      • Further purification and buffer exchange

      • Assessment of oligomeric state

    4. Detergent considerations:

      • Initial solubilization may require stronger detergents

      • Purification and storage often benefit from milder detergents

      • Consider detergent screening to identify optimal conditions

    A sample purification protocol might include:

    StepBuffer CompositionConditions
    Membrane extraction50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol4°C
    SolubilizationExtraction buffer + 1% DDM4°C, 1-2 hours
    IMAC bindingExtraction buffer + 0.05% DDM4°C
    IMAC washingBinding buffer + 20-50 mM imidazole4°C
    IMAC elutionBinding buffer + 250-500 mM imidazole4°C
    Size exclusion20 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.03% DDM4°C

    Protein quality should be assessed at each step using SDS-PAGE, Western blotting, and potentially mass spectrometry to confirm identity.

  • What functional assays can be used to characterize AaeA activity and substrate specificity?

    Characterizing the functional activity of AaeA requires assays that can measure its contribution to efflux activity, ideally in conjunction with its partner protein AaeB. Several complementary approaches can be employed:

    1. Whole-cell-based assays:

      • Susceptibility testing: MIC determination in the presence/absence of AaeA expression

      • Efflux inhibitor studies: Testing whether known efflux inhibitors affect AaeA-mediated resistance

      • Fluorescent substrate accumulation: Using fluorescent dyes that are potential substrates

    2. Membrane vesicle-based assays:

      • Inside-out vesicles can be prepared from cells expressing AaeA-AaeB

      • Transport activity measured using substrate accumulation or efflux

    3. Reconstituted systems:

      • Purified AaeA and AaeB can be reconstituted into proteoliposomes

      • Direct measurement of transport activity across the membrane

    4. Binding assays:

      • Isothermal titration calorimetry (ITC) to measure substrate binding

      • Surface plasmon resonance (SPR) for binding kinetics

      • Fluorescence-based binding assays

    A comprehensive characterization would include determining:

    ParameterMethodExpected Outcome
    Substrate specificityTransport assays with various compoundsProfile of transported substrates
    Kinetic parametersConcentration-dependent transportKm and Vmax values
    Energy dependenceTransport in the presence of metabolic inhibitorsATP or PMF requirement
    Inhibitor sensitivityTransport in the presence of efflux inhibitorsInhibition profile
    Partner protein dependenceComparison of AaeA alone vs. AaeA+AaeBFunctional interaction confirmation

    These approaches would provide a comprehensive understanding of AaeA's functional properties and its role in E. fergusonii physiology.

  • How can researchers investigate the regulation of aaeA gene expression in E. fergusonii?

    Understanding the regulation of aaeA expression is crucial for elucidating its physiological role and potential contribution to antimicrobial resistance. A systematic approach might include:

    1. Promoter analysis:

      • Computational identification of promoter elements and potential transcription factor binding sites

      • Reporter gene assays using the aaeA promoter fused to reporter genes (e.g., lacZ, gfp)

    2. Transcriptional studies:

      • qRT-PCR to measure aaeA mRNA levels under various conditions

      • RNA-seq to identify co-regulated genes in the AaeA regulon

      • Primer extension or 5' RACE to map transcription start sites

    3. Regulatory protein identification:

      • DNA-protein interaction assays (EMSA, DNase footprinting)

      • Chromatin immunoprecipitation (ChIP) if antibodies are available

      • One-hybrid or bacterial two-hybrid screens to identify regulatory proteins

    4. Environmental and stress response analysis:

      • Gene expression under various growth conditions (pH, temperature, nutrient limitation)

      • Response to potential substrates or inducers

      • Antibiotic exposure effects on expression

    Conditions to test might include:

    ConditionRationaleExpected Outcome
    Aromatic compound exposurePotential inducers as substratesIncreased expression
    Sub-inhibitory antibiotic concentrationsStress responsePotential modulation
    Growth phase variationMetabolic state changesExpression pattern changes
    Oxygen limitationMetabolic shiftsExpression changes
    pH stressEnvironmental adaptationPotential regulation

    Results from these approaches would provide insights into when and why E. fergusonii expresses the AaeA-AaeB efflux system, potentially revealing its physiological importance and role in adaptation to different environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.