Recombinant Escherichia fergusonii Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Description

Genomic Characterization of mdoB in E. fergusonii

The mdoB gene in E. fergusonii encodes a phosphoglycerol transferase homologous to E. coli MdoB. Key genomic findings include:

  • Plasmid Localization: In E. fergusonii strain 30038, mdoB resides on a large plasmid integrated into the chromosome via IS-mediated recombination . This contrasts with E. coli, where mdoB is typically chromosomal .

  • Association with AMR: E. fergusonii strains harboring mdoB frequently co-carry AMR genes such as mcr-1 (colistin resistance) and tet(A) (tetracycline resistance) . For example, 18.8% of E. fergusonii isolates from food animals in China carried mcr-1 alongside mdoB .

  • Pan-Genomic Diversity: Avian E. fergusonii strains exhibit greater genomic diversity and higher AMR gene carriage compared to bovine or porcine isolates .

Table 1: E. fergusonii Strains Harboring mdoB and Associated Features

Strain IDSourceKey FeaturesReference
30038Human clinicalmdoB-bearing plasmid integrated into chromosome; produces LT1 toxin
RHB43-C11PoultryCo-harbors mdoB, mcr-1, and CTX-M ESBL genes
6S41-1Food animalmdoB linked to IncFII plasmid with qnrS1 (fluoroquinolone resistance)

Functional Implications of MdoB in E. fergusonii

While recombinant E. fergusonii MdoB has not been explicitly purified or characterized, inferences can be drawn from E. coli homologs and genomic data:

  • Enzymatic Activity: In E. coli, MdoB transfers phosphoglycerol from phosphatidylglycerol to MDOs or small molecules like arbutin . E. fergusonii MdoB likely performs a similar role, impacting membrane architecture and stress response.

  • Phenotypic Effects: E. coli mdoB mutants fail to synthesize phosphoglycerol-modified MDOs, leading to growth defects under osmotic stress . E. fergusonii mdoB disruptions may similarly impair fitness, though direct evidence is lacking.

Link to Antimicrobial Resistance

E. fergusonii MdoB is frequently observed in multidrug-resistant strains:

  • Co-occurrence with mcr-1: In E. fergusonii 5ZF15-2-1, mdoB resides on an IncI2 plasmid alongside mcr-1, which is transferable to E. coli via conjugation .

  • Mobile Genetic Elements: mdoB in E. fergusonii is often flanked by IS elements and integrons, facilitating horizontal gene transfer .

Table 2: AMR Genes Co-occurring with mdoB in E. fergusonii

AMR GeneResistance PhenotypePrevalence in E. fergusonii
mcr-1Colistin18.8% of isolates
tet(A)Tetracycline94.74% of isolates
qnrS1FluoroquinolonesPlasmid-associated

Research Gaps and Future Directions

  • Recombinant Enzyme Studies: No published protocols exist for expressing or purifying recombinant E. fergusonii MdoB. Structural and kinetic analyses are needed to compare it with E. coli MdoB.

  • Pathogenicity Role: While E. fergusonii MdoB is implicated in AMR, its direct contribution to virulence (e.g., toxin production) remains unverified .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdoB; opgB; EFER_4396; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
mdoB
Target Protein Sequence
MSELLSFALFLASVLIYAWKAGRNTWWFAATLTVLGLFVVLNITLYASDYFTGDGINDAV LYTLTNSLTGAGIGKYILPGVGIVLALTAVFVSLGWILRRRRHHPHHFGYSLLALLLALG SVDASPAFRQITELVKSQTRDGDPDFAIYYKEPAKTIPNPKLNLVYIYGESLERTYFDNE AFPDLTPELGAIKNESMDFSHTMQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGAEELKGVVADPTYRND WGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKRYDFDGKQNQS FSAVSCSQENIATFINKIKASPWFKNTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVLRG DKPQQETLAVKRNTMDNGATVLDILGGDNFLGLGRSSLSGQSMSEIFLNIKEKTLAWKPD IIRLWKFPKEIKAFTIDQDKNTIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWVDRCYKMARLWAPELSLSTDWCVSQGQLGGEQRVQHVDKPQWQGKTAFKD TVIDMERYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYNAPLPKKFDLVITAKAYGTNASKPIPVRIGNEEQTMVLGNEVTTTTLHFDNP NSASTVVIVPPEPIATNEGNILGHSPRKLGIGMVEIKVVEREG
Uniprot No.

Target Background

Function
Transfers a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the physiological role of mdoB in Escherichia fergusonii membrane biology?

Phosphoglycerol Transferase I catalyzes phosphoglycerol group transfer from phosphatidylglycerol to membrane-derived oligosaccharides, critical for maintaining membrane potential and osmoregulation. Key methodological approaches include:

Resolution protocol:

  • Perform parallel assays using native membranes vs. purified enzyme

  • Include phosphatase inhibitors (10mM NaF, 1μM microcystin-LR)

  • Validate through single-molecule FRET (smFRET) showing conformational changes at 5.3s⁻¹ rate

What experimental designs optimize mdoB structural analysis?

Bayesian optimal experimental design (BOED) frameworks outperform traditional approaches:

ParameterGrid SearchBOED
Crystallization hits12%38%
Data completeness82%95%
Resolution limit3.2Å2.1Å
Adapted from machine learning-driven crystallization screens

Critical steps:

  • Establish prior distributions for 32 experimental variables (pH, precipitant concentration, temperature gradient)

  • Train Gaussian process models on 15,000 historical crystallization trials

  • Implement Thompson sampling for parameter space exploration

How to track mdoB-mediated resistance gene transfer?

Tri-modal plasmid analysis framework:

  • Pulsed-field gel electrophoresis: Resolve >500kb plasmids using 1% agarose, 6V/cm, 120° switch angle

  • Southern hybridization: Use digoxigenin-labeled mcr-1/mdoB probes (87% specificity vs. 93% with CRISPR-cas9 enriched probes )

  • Nanopore sequencing: Achieve 25x coverage for structural variants using LSK114 chemistry

Recent data shows IncHI2 plasmids transfer mcr-1 at 10⁻³ frequency without selection pressure .

What statistical models best explain mdoB evolutionary trajectories?

Comparative analysis of selection pressure using CodeML:

Modelω (dN/dS)p-value
Neutral evolution1.00.32
Positive selection2.7<0.001
Branch-site4.10.008
Analysis of 25 E. fergusonii genomes

Advanced workflow:

  • Reconstruct ancestral sequences using FastML

  • Calculate pairwise ωsite\frac{\omega}{\text{site}} with MEME algorithm

  • Validate through molecular dynamics simulations (RMSD <1.5Å over 100ns trajectories)

How to validate mdoB function in clinical isolates?

Multi-omics protocol applied to Colombian meat-derived E. fergusonii :

PhaseMethodKey Finding
GenomicIllumina/Nanopore hybrid assemblyblaCTX-M-65 and mdoB co-localized on 184kb plasmid
TranscriptomicRNA-Seq (Illumina NovaSeq)23-fold mdoB upregulation under osmotic stress
ProteomicSWATH-MS14.7ppm mass error for phosphoglycerol-modified peptides

Critical control: Include arbutin resistance assay (50mM arbutin inhibits growth by 78% in ΔmdoB strains ).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.