Recombinant Escherichia fergusonii Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
kdpC; EFER_2414; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
kdpC
Target Protein Sequence
MRGLRPALSTFLFLLLITGGVYPLLTTALGQWWFPWQANGSLIREGDTVRGSALIGQNFT GNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAALRAANPDASTSVPVEL VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVE LNLALDKLDE
Uniprot No.

Target Background

Function

The KdpC subunit is part of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Functionally, KdpC acts as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing KdpB subunit by forming a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of kdpC in the Kdp complex of Escherichia fergusonii?

The kdpC protein serves as a critical assembly and stabilization component in the Kdp complex, which functions as a high-affinity ATP-driven K+ transport system. Based on studies in related organisms like E. coli, kdpC forms strong interactions with the kdpA subunit, acting as one of the connecting links between the energy-delivering subunit kdpB and the K+-transporting subunit kdpA . This structural arrangement enables the complex to maintain its functionality in low potassium environments, where the bacterium must scavenge available potassium ions with high efficiency.

How does the kdpC subunit in E. fergusonii differ from that in E. coli?

While both proteins share significant sequence homology, E. fergusonii kdpC demonstrates subtle structural variations that affect complex assembly and stability. Comparative genomic analysis indicates conservation of key functional domains responsible for protein-protein interactions, but species-specific variations exist particularly in the C-terminal region. These differences may contribute to variations in potassium affinity and transport efficiency observed between the two organisms, potentially relating to their different ecological niches and physiological requirements.

What experimental approaches can verify kdpC interactions with other Kdp complex components?

Several complementary methodologies can verify protein-protein interactions:

MethodApplicationAdvantagesLimitations
Co-immunoprecipitationIdentification of native protein complexesPreserves physiological conditionsRequires specific antibodies
Yeast two-hybridBinary interaction mappingHigh-throughput capabilityPotential for false positives
Affinity chromatographyComplex purificationEnables isolation of intact complexesMay disrupt weak interactions
FRET analysisIn vivo interaction confirmationReal-time monitoring possibleTechnical complexity

The most definitive approach combines mutant strain analysis with dye-ligand affinity columns after solubilization with non-ionic detergent. This method has demonstrated that when kdpC expression is absent, the remaining subunits fail to co-purify, confirming kdpC's essential role in complex stability .

What are the optimal conditions for recombinant expression of E. fergusonii kdpC?

A methodically designed expression system is critical for obtaining functional recombinant kdpC. Consider these parameters:

  • Expression vector selection: pET-based systems with T7 promoters typically yield high expression levels for membrane-associated proteins like kdpC.

  • Host strain optimization: E. coli BL21(DE3) derivatives designed for membrane protein expression (e.g., C41/C43) often produce better results than standard strains.

  • Induction protocol: Lower temperatures (16-25°C) and reduced IPTG concentrations (0.1-0.5 mM) minimize inclusion body formation and enhance proper membrane insertion.

  • Culture medium: Defined media supplemented with specific ions can enhance proper folding. For kdpC specifically, limit potassium concentration to induce native expression of support proteins.

  • Extraction protocols: Gentle detergent solubilization maintains protein-protein interactions critical for functional studies.

When designing your experimental methodology, include appropriate controls that account for potential variations in protein folding and membrane integration .

How should researchers design experiments to study kdpC function in potassium transport?

Effective experimental design requires:

  • Variable definition: Clearly define independent variables (e.g., kdpC expression levels, mutations, environmental K+ concentration) and dependent variables (K+ transport rates, cell growth under K+ limitation, complex assembly) .

  • Hypothesis formulation: Develop specific, testable hypotheses about kdpC function. For example: "Site-directed mutation of amino acid X in kdpC will reduce kdpA-kdpB interaction strength by Y%, resulting in Z% reduction in K+ transport."

  • Control implementation: Include both positive controls (wild-type kdpC) and negative controls (kdpC deletion mutants) alongside complementation tests to validate functional relationships.

  • Measurement standardization: Employ consistent methodologies for assessing K+ transport, such as:

    • Radioisotope (86Rb+) uptake assays

    • Growth rate determination in K+-limited media

    • Membrane potential measurements

    • ATP hydrolysis rate quantification

  • Statistical analysis planning: Design experiments with sufficient replication (n≥3) to enable robust statistical testing and minimize type I/II errors .

What approaches can resolve contradictory findings about kdpC membrane topology?

Contradictory findings regarding kdpC membrane topology can be methodically resolved through:

  • Complementary structural methods: Combine computational prediction algorithms with experimental verification techniques. For instance, hydropathy analyses provide initial topology predictions, which can then be validated using:

    • Cysteine accessibility scanning: Introduce single cysteine residues throughout the protein and test their accessibility to membrane-impermeable reagents

    • Epitope insertion studies: Insert epitope tags at various positions and determine their accessibility using antibodies

    • Protease protection assays: Examine vulnerability of protein segments to protease digestion

  • Cross-validation approach: Implement at least three independent methods and triangulate results to identify consensus topology.

  • Species-comparative analysis: Analyze topological conservation across Escherichia species to identify functionally constrained regions that likely maintain consistent orientation.

  • Structural biology integration: When possible, validate topology models using data from X-ray crystallography, cryo-EM, or NMR studies of the Kdp complex components.

This systematic approach helps distinguish genuine structural features from methodological artifacts that may have led to contradictory results in previous studies.

How can researchers quantify the contribution of kdpC to Kdp complex stability?

Quantitative assessment of kdpC's contribution to complex stability requires:

  • Thermal stability assays: Measure complex dissociation temperatures in presence versus absence of kdpC using differential scanning calorimetry or fluorescence-based thermal shift assays.

  • Detergent sensitivity profiling: Systematically test resistance of assembled complexes to increasingly harsh detergents, comparing wild-type to kdpC-deletion mutants.

  • Real-time binding kinetics: Employ surface plasmon resonance or biolayer interferometry to determine association/dissociation constants between kdpC and other complex components.

  • Hydrogen-deuterium exchange mass spectrometry: Map interaction interfaces and conformational changes by analyzing differential solvent accessibility.

  • Computational stability prediction: Utilize molecular dynamics simulations to calculate free energy changes in complex formation with and without kdpC.

Data from these approaches can be integrated to construct a comprehensive model of kdpC's role in complex stability under various physiological conditions.

What are common pitfalls in purifying functional recombinant E. fergusonii kdpC?

Several technical challenges frequently arise during kdpC purification:

  • Membrane protein solubilization: KdpC's strong interaction with kdpA can complicate detergent-based extraction. Implement a systematic detergent screening approach, testing multiple detergent types (maltoside, glucoside, and fos-choline series) at various concentrations.

  • Protein aggregation: During concentration steps, kdpC may aggregate, particularly when separated from other complex components. Maintain a minimum concentration of compatible solutes (glycerol 5-10% or sucrose 2-5%) throughout purification procedures.

  • Loss of binding partners: The stability of kdpC depends on its interaction with kdpA . When designing purification strategies, consider co-expression with kdpA or stabilization through nanodiscs or amphipols.

  • Tag interference: N-terminal tags may disrupt membrane insertion, while C-terminal modifications can interfere with kdpA interaction. Test multiple tag positions and include tag removal options in your purification scheme.

  • Functional validation: Purified protein may appear structurally intact but lack functionality. Implement activity assays at multiple purification stages to track functional preservation.

How can researchers address challenges in experimental design when comparing wild-type and mutant kdpC variants?

Robust experimental comparisons between wild-type and mutant kdpC require careful methodological design:

What cutting-edge approaches are advancing our understanding of kdpC structure-function relationships?

Several frontier methodologies are yielding new insights:

  • Cryo-electron microscopy: Recent advances in resolution have enabled visualization of subtle conformational changes in membrane protein complexes like Kdp during ion transport cycles.

  • Single-molecule FRET: These techniques allow real-time monitoring of dynamic changes in protein conformation during transport processes.

  • Nanobody-assisted crystallography: Use of camelid antibody fragments as crystallization chaperones is overcoming traditional barriers to membrane protein structure determination.

  • Native mass spectrometry: This emerging approach can analyze intact membrane protein complexes, providing insights into subunit stoichiometry and complex stability.

  • Deep mutational scanning: Systematic mutation libraries combined with functional selection provide comprehensive maps of structure-function relationships across the entire protein sequence.

Researchers implementing these approaches should carefully design appropriate controls that distinguish between methodological artifacts and genuine biological phenomena.

How can quasi-experimental designs be applied to study kdpC function in environmental E. fergusonii isolates?

When working with environmental isolates where genetic manipulation may be challenging, quasi-experimental approaches offer valuable alternatives:

  • Interrupted time series (ITS) analysis: Monitor changes in kdpC expression and K+ transport capacity under controlled environmental shifts, such as progressive K+ limitation or osmotic stress conditions .

  • Natural variant comparison: Identify and compare naturally occurring kdpC variants from diverse E. fergusonii isolates, correlating sequence variations with functional differences in transport capability or stress response.

  • Pre-post designs with nonequivalent control groups: Compare isolates with naturally occurring kdpC variations to those with standard sequences when exposed to experimental treatments .

  • Stepped wedge approaches: Introduce environmental changes sequentially across different isolate populations to assess adaptation patterns related to Kdp complex function.

These approaches require careful attention to potential confounding variables and extraneous factors that might influence the observed relationships between kdpC variations and phenotypic outcomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.