Recombinant Escherichia fergusonii Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms maintain a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize development accordingly.
Synonyms
arnE; EFER_0911; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
arnE
Target Protein Sequence
MIWLVLILASLLSVTGQLCQKQATRPVAINKRRKHIALWLGLGLVCLGLAMVLWLLVLQT VPVGIAYPMLSLNFVWVTLAATKLWHEPVSFRHWCGVAFIIGGIVILGSTV
Uniprot No.

Target Background

Function
This protein functions as a translocator, moving 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasm to the periplasmic side of the inner membrane.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Escherichia fergusonii and how does it differ from Escherichia coli?

Escherichia fergusonii is a Gram-negative, rod-shaped bacterial species within the family Enterobacteriaceae. First isolated from human blood samples, it was named after American microbiologist William W. Ferguson. E. fergusonii is closely related to the well-known Escherichia coli, with DNA hybridization showing approximately 64% similarity with E. coli-Shigella .

Taxonomically, E. fergusonii belongs to:

  • Domain: Bacteria

  • Kingdom: Pseudomonadati

  • Phylum: Pseudomonadota

  • Class: Gammaproteobacteria

  • Order: Enterobacterales

  • Family: Enterobacteriaceae

  • Tribe: Escherichieae

  • Genus: Escherichia

  • Species: E. fergusonii

While E. fergusonii shares many characteristics with E. coli, it demonstrates distinct pathogenicity profiles, antimicrobial resistance patterns, and genomic features that researchers should be aware of when working with this organism.

What is the biological function of ArnE in bacterial systems?

ArnE (previously known as PmrM) functions as a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase, which is critical for bacterial antimicrobial resistance mechanisms. This protein works in concert with ArnF (formerly PmrL) to transport undecaprenyl phosphate-alpha-L-Ara4N across the inner membrane .

The primary function of ArnE is to facilitate the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane . This translocation is crucial for the subsequent modification of lipid A with the L-Ara4N moiety, which confers resistance to polymyxin and other cationic antimicrobial peptides in Enterobacteriaceae including E. coli and Salmonella typhimurium .

Knockout studies have demonstrated that chromosomal inactivation of arnE in polymyxin-resistant strains switches the phenotype to polymyxin-sensitive, confirming its essential role in antimicrobial resistance pathways .

What is the molecular structure of ArnE and how does it contribute to its function?

ArnE is a relatively small protein with 111 amino acid residues and a molecular weight of approximately 12,104.76 Da. It has a theoretical isoelectric point (pI) of 10.884, indicating a basic protein nature .

The protein contains multiple transmembrane regions that anchor it within the bacterial inner membrane, which is essential for its function as part of a flippase complex. These hydrophobic domains are arranged to form a channel-like structure that facilitates the translocation of the undecaprenyl phosphate-alpha-L-Ara4N substrate across the membrane .

ArnE works in conjunction with ArnF to form a complete flippase complex that enables the directional transport of the L-Ara4N-modified lipid substrate. This structural arrangement is critical for maintaining the proper topology of bacterial cell envelope modifications that confer antimicrobial resistance.

How is the arnE gene organized within the arn operon and how is it regulated?

The arnE gene (formerly pmrL) is located within a seven-gene operon that includes arnB, arnC, arnA, arnD, arnT, arnE, and arnF (previously designated as pmrHFIJKLM in Salmonella typhimurium) . This operon is regulated by the PmrA transcription factor, which responds to environmental signals such as low Mg²⁺, Fe³⁺, and mildly acidic pH.

The operon structure ensures coordinated expression of all genes necessary for the biosynthesis and attachment of L-Ara4N to lipid A:

  • arnB, arnC, arnA, and arnD encode enzymes involved in the biosynthesis of L-Ara4N

  • arnT encodes the transferase that attaches L-Ara4N to lipid A

  • arnE and arnF encode the flippase complex components that transport the intermediate substrate

Regulation of this operon is primarily controlled through two-component regulatory systems:

  • PmrA/PmrB system that directly senses environmental signals

  • PhoP/PhoQ system that can cross-regulate the PmrA/PmrB system through PmrD in some species

These regulatory mechanisms ensure that the resistance mechanism is expressed under appropriate environmental conditions that signal potential exposure to antimicrobial peptides.

What methods are currently used for the heterologous expression and purification of recombinant ArnE?

Expression Systems:

  • E. coli-based expression: Using BL21(DE3) or C43(DE3) strains with specialized vectors (pET-based) containing solubility-enhancing fusion tags (MBP, SUMO, or TrxA)

  • Cell-free expression systems: For membrane proteins that may be toxic when overexpressed in living cells

Purification Protocol:

  • Cell lysis using either French press or sonication in buffer containing appropriate detergents (typically DDM, LDAO, or C12E8)

  • Membrane fraction isolation through ultracentrifugation

  • Solubilization of membrane proteins using selected detergents

  • Affinity chromatography using His-tag or other fusion tags

  • Size exclusion chromatography for final purification

  • Optional reconstitution into proteoliposomes for functional studies

Critical Considerations:

  • Selection of appropriate detergents is crucial for maintaining protein stability and function

  • Addition of stabilizing agents (glycerol, specific lipids) often improves yield and activity

  • Temperature optimization during expression (typically 16-25°C) to prevent inclusion body formation

For functional studies, it is recommended to co-express ArnE with ArnF to obtain the complete flippase complex, as individual subunits may not properly fold or function independently .

How can researchers assess the functional activity of recombinant ArnE in vitro?

Functional assessment of recombinant ArnE activity presents unique challenges due to its role in membrane transport. Several methodologies have been developed to address this:

1. Proteoliposome-based Flippase Assays:

  • Purified ArnE (preferably co-purified with ArnF) is reconstituted into proteoliposomes

  • Inside-out vesicles are prepared containing fluorescently labeled or radiolabeled undecaprenyl phosphate-alpha-L-Ara4N

  • Transport activity is measured by monitoring substrate translocation across the membrane

2. Surface Labeling Approaches:

  • Similar to methods described in published studies using N-hydroxysulfosuccinimidobiotin to assess the periplasmic concentration of undecaprenyl phosphate-alpha-L-Ara4N

  • This approach compares labeling efficiency between wild-type and mutant strains

3. Antimicrobial Susceptibility Testing:

  • Complementation of arnE-knockout strains with recombinant arnE constructs

  • Measuring restoration of polymyxin resistance using standard MIC (Minimum Inhibitory Concentration) assays

  • This indirect method confirms in vivo functionality of the expressed protein

4. Binding Assays:

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to assess binding of ArnE to its substrate

  • These methods require careful preparation of protein samples in appropriate detergent micelles or nanodiscs

When designing these assays, it's important to include appropriate positive and negative controls, such as known inactive mutants of ArnE and related flippases from other bacterial species.

What is the clinical significance of E. fergusonii and what virulence factors has it been found to possess?

E. fergusonii is increasingly recognized as an opportunistic pathogen with significant clinical implications:

Clinical Presentations:

  • Diarrheal illness in humans and animals

  • Wound infections in humans

  • Urinary tract infections

  • Bacteremia and septicemia

  • Meningitis, mastitis, and abortion in animals

Key Virulence Factors Identified:

Virulence FactorFunctionPrevalence in E. fergusonii
Heat-labile enterotoxin 1 (LT1)Causes secretory diarrheaIdentified in human and poultry isolates
Heat-stable toxin (STa)Disrupts intestinal fluid balanceReported in some isolates
eae geneIntimin protein for host cell attachmentDetected in some strains
issIncreased serum survivalPresent in multiple isolates
prfBPeptide chain release factorIdentified in genomic studies
ireAIron-regulated virulence factorPresent in many isolates

A particularly significant finding is the recent identification of the first LT1-producing E. fergusonii strain (strain 30038) from a patient with diarrhea in Japan . Comparative genomics revealed that while the elt1 gene (encoding LT1) was present on a plasmid in poultry isolates, in the human isolate it had integrated into the chromosome via insertion sequence-mediated recombination, potentially conferring greater stability to this virulence factor .

The presence of these virulence determinants, particularly those similar to pathogenic E. coli strains, suggests that E. fergusonii has significant pathogenic potential that requires further surveillance and characterization.

How can genomic and comparative analyses be used to understand the evolution of ArnE in E. fergusonii?

Advanced genomic approaches offer powerful insights into the evolution and function of ArnE in E. fergusonii:

Phylogenomic Analysis Approaches:

  • Whole-genome sequencing of diverse E. fergusonii isolates to understand strain diversity

  • Comparative genomics with other Enterobacteriaceae to track evolutionary history of the arn operon

  • Selective pressure analysis using dN/dS ratios to identify conserved functional domains

  • Ancestral sequence reconstruction to infer evolutionary trajectories of ArnE

Key Research Findings from Comparative Analyses:

  • Pangenomic analysis of 131 E. fergusonii genomes revealed an open pan-genome (0 < γ < 1), indicating ongoing genomic diversification

  • Avian strains demonstrated greater genomic diversity than isolates from other sources

  • Phylogenomic analysis showed clustering based on isolation source and geographical location

For researchers pursuing this direction, a comprehensive approach would include:

  • Collection of diverse E. fergusonii isolates across different geographical regions and hosts

  • High-quality genome sequencing using both short and long-read technologies

  • Detailed annotation focusing on the arn operon and related resistance genes

  • Synteny analysis to identify genomic rearrangements affecting ArnE function

  • Transcriptomic studies under different selective pressures to understand regulatory networks

Such analyses could reveal how environmental and host adaptations have shaped ArnE evolution and function across different E. fergusonii lineages.

What novel experimental approaches could elucidate the structural interactions between ArnE and ArnF in the functional flippase complex?

Understanding the structural basis of ArnE-ArnF interactions presents significant challenges due to the membrane-embedded nature of these proteins. Several cutting-edge approaches could advance this research area:

1. Cryo-Electron Microscopy Approaches:

  • Single-particle cryo-EM of detergent-solubilized or nanodisc-reconstituted ArnE-ArnF complexes

  • Cryo-electron tomography of membrane preparations containing overexpressed ArnE-ArnF

  • These approaches can potentially achieve near-atomic resolution of the complete flippase structure

2. Integrative Structural Biology:

  • Combining X-ray crystallography of soluble domains

  • NMR spectroscopy for dynamic regions

  • Cross-linking mass spectrometry (XL-MS) to identify interaction interfaces

  • Molecular dynamics simulations to model conformational changes

3. Advanced Biophysical Techniques:

  • Single-molecule FRET to monitor conformational changes during substrate transport

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify substrate binding regions

  • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

4. Genetic Approaches to Structure-Function Relationship:

  • CRISPR-based scanning mutagenesis to identify essential residues

  • Suppressor mutation analysis to identify interacting regions

  • Directed evolution to select for mutants with enhanced activity

These approaches should be complemented with functional assays that directly measure flippase activity, potentially using fluorescent or spin-labeled substrate analogs to monitor translocation events in real-time.

How might the understanding of ArnE function in E. fergusonii contribute to novel antimicrobial development strategies?

The critical role of ArnE in antimicrobial peptide resistance makes it an attractive target for new therapeutic approaches:

Potential Antimicrobial Development Strategies:

1. Direct ArnE Inhibitors:

  • High-throughput screening of compound libraries against reconstituted ArnE-ArnF flippase

  • Structure-based design of small molecules that block the substrate binding site

  • Peptide-based inhibitors that disrupt ArnE-ArnF interactions

  • Development of substrate analogs that competitively inhibit flippase function

2. Adjuvant Therapies:

  • ArnE inhibitors could be used in combination with existing polymyxins

  • Formulation of compounds that synergize with host antimicrobial peptides

  • Targeting regulatory pathways (PmrA/PmrB) that control arnE expression

3. Novel Screening Approaches:

  • Genetic reporter systems (fluorescent or luminescent) linked to the activity of the arn pathway

  • Bacterial surface charge analysis as a proxy for ArnE function

  • Whole-cell screening using polymyxin-sensitive indicator strains

Challenges and Considerations:

  • Membrane proteins like ArnE present difficulties for traditional drug development pipelines

  • Species-specific differences in the arn operon may require tailored approaches

  • Potential for rapid resistance development through alternative pathways

  • Need for extensive in vivo testing to ensure effectiveness in physiological conditions

Research in this area could lead to novel combination therapies that restore the effectiveness of existing antibiotics against multidrug-resistant E. fergusonii and related pathogens.

What are the common challenges in working with recombinant E. fergusonii ArnE and how can they be addressed?

Researchers working with recombinant E. fergusonii ArnE frequently encounter several technical challenges:

Challenge 1: Low Expression Levels

  • Problem: ArnE often expresses poorly in heterologous systems due to its hydrophobic nature and potential toxicity.

  • Solutions:

    • Use specialized E. coli strains designed for membrane protein expression (C41, C43, Lemo21)

    • Optimize induction conditions (lower IPTG concentrations, reduced temperature)

    • Consider fusion partners that enhance folding and solubility (SUMO, MBP)

    • Explore alternative expression systems (yeast, insect cells)

Challenge 2: Protein Aggregation and Inclusion Body Formation

  • Problem: Improperly folded ArnE tends to aggregate or form inclusion bodies.

  • Solutions:

    • Co-express with ArnF and potential chaperones

    • Include stabilizing agents in buffers (glycerol, specific lipids)

    • Optimize detergent selection for membrane extraction

    • Consider refolding protocols if inclusion bodies are unavoidable

Challenge 3: Functional Assay Development

  • Problem: Assessing flippase activity requires specialized techniques not commonly available.

  • Solutions:

    • Develop fluorescence-based assays using labeled substrates

    • Use indirect measurements through antimicrobial susceptibility

    • Establish collaborations with specialized membrane protein laboratories

    • Implement complementation assays in arnE knockout strains

Challenge 4: Protein Stability During Purification

  • Problem: ArnE may rapidly lose activity during purification steps.

  • Solutions:

    • Minimize time between extraction and final storage

    • Include protease inhibitors and reducing agents in all buffers

    • Maintain consistent cold temperatures throughout purification

    • Immediately reconstitute into proteoliposomes or nanodiscs after purification

A systematic approach to optimization, beginning with expression screening followed by detergent screening and purification optimization, is recommended for successful work with this challenging membrane protein.

How can researchers investigate the interplay between ArnE function and other antimicrobial resistance mechanisms in E. fergusonii?

Studying the complex interplay between different resistance mechanisms requires sophisticated experimental designs:

Methodological Approaches:

1. Gene Knockout and Complementation Studies:

  • Generate single and combinatorial knockouts of arnE and other resistance genes

  • Assess changes in MIC values across different antimicrobial classes

  • Complement with wild-type and mutant variants to validate phenotypes

  • Use CRISPR-Cas9 systems for precise genomic modifications

2. Transcriptomic and Proteomic Analyses:

  • RNA-Seq under different antimicrobial stresses to identify co-regulated pathways

  • Quantitative proteomics to measure changes in protein abundance

  • Ribosome profiling to assess translational regulation

  • ChIP-Seq to identify regulatory interactions

3. Biochemical Interaction Studies:

  • Pull-down assays to identify protein-protein interactions

  • Bacterial two-hybrid systems to screen for interacting partners

  • Surface plasmon resonance to quantify binding kinetics

  • Fluorescence microscopy to localize protein complexes

4. Physiological Characterization:

  • Membrane permeability assays using fluorescent dyes

  • Surface charge measurements using zeta potential

  • Lipid A modification analysis by mass spectrometry

  • Electron microscopy to assess membrane structural changes

Research Design Considerations:

  • Include appropriate control strains (parent, single mutants, complemented strains)

  • Test under various growth conditions that mimic different host environments

  • Consider polymicrobial interactions that may occur in clinical settings

  • Validate findings using clinical isolates with different resistance profiles

This multifaceted approach can reveal how ArnE-mediated resistance mechanisms integrate with other pathways to create the comprehensive resistance phenotype observed in multidrug-resistant E. fergusonii strains.

How should researchers interpret contradictory results when studying ArnE function in different E. fergusonii strains?

Research on ArnE function may yield seemingly contradictory results across different E. fergusonii strains. A systematic approach to reconciling such discrepancies includes:

Analysis Framework for Contradictory Results:

Case Example:
The apparent contradiction between ArnE function in clinical versus environmental isolates might be explained through comprehensive analysis of regulatory network differences, as environmental strains may have evolved different control mechanisms for the arn operon based on their exposure history.

What bioinformatic approaches are most effective for analyzing E. fergusonii ArnE in the context of antimicrobial resistance genomics?

Modern bioinformatic approaches provide powerful tools for analyzing ArnE in the broader context of antimicrobial resistance:

Recommended Bioinformatic Workflow:

  • Sequence Analysis and Annotation:

    • Use specialized annotation pipelines for membrane proteins

    • Identify conserved domains and transmembrane regions

    • Apply homology modeling based on related flippase structures

    • Predict post-translational modifications that may affect function

  • Comparative Genomics:

    • Pan-genome analysis to determine core and accessory genome components

    • Identify synteny conservation of the arn operon across strains

    • Detect horizontal gene transfer events through sequence composition analysis

    • Apply phylogenetic approaches to understand evolutionary relationships

  • Resistance Gene Context Analysis:

    • Map genomic islands and mobile genetic elements

    • Identify co-localized resistance determinants

    • Analyze promoter regions for regulatory motifs

    • Detect insertion sequences that may affect gene expression

  • Integrated Multi-Omics Analysis:

    • Correlate genomic features with transcriptomic and proteomic data

    • Implement network analysis to identify functional gene clusters

    • Use machine learning to predict resistance phenotypes from genomic data

    • Develop visualization tools to represent complex resistance mechanisms

Example Pipeline Components:

Analysis TypeRecommended ToolsApplication to ArnE Research
Gene predictionProkka, PGAPAccurate annotation of arn operon genes
Resistance gene detectionResFinder, CARD-RGIIdentification of ArnE and co-occurring resistance genes
Comparative genomicsRoary, OrthoMCLAnalysis of ArnE conservation across strains
Phylogenetic analysisIQ-TREE, RAxMLEvolutionary history of the arn operon
Mobile element detectionISfinder, MobileElementFinderIdentification of insertion sequences affecting arnE
Structural predictionTMHMM, Phobius, AlphaFoldPrediction of ArnE transmembrane topology

These approaches can reveal patterns of co-evolution between ArnE and other resistance mechanisms, providing a more comprehensive understanding of E. fergusonii's adaptation to antimicrobial pressure.

How might research on E. fergusonii ArnE contribute to surveillance of emerging antimicrobial resistance?

Research on E. fergusonii ArnE has significant implications for antimicrobial resistance surveillance:

Surveillance Applications:

  • Molecular Markers for Resistance Monitoring:

    • Development of PCR-based assays targeting arnE and regulatory mutations

    • Design of multiplex assays that detect both intrinsic (arnE) and acquired (mcr) resistance genes

    • Implementation of targeted sequencing protocols for high-risk isolates

    • Creation of databases documenting arnE sequence variants linked to resistance phenotypes

  • Predictive Diagnostics:

    • Integration of arnE sequence data into machine learning algorithms predicting treatment outcomes

    • Development of rapid phenotypic tests that correlate with ArnE activity

    • Risk assessment tools for clinical decision-making based on resistance profiles

    • Early warning systems for emerging high-risk E. fergusonii lineages

  • One Health Surveillance Framework:

    • Monitoring ArnE variants across human, animal, and environmental isolates

    • Tracking transmission patterns between different hosts and reservoirs

    • Assessing impact of agricultural antimicrobial use on resistance development

    • Evaluating effectiveness of intervention strategies across different sectors

Practical Implementation Strategy:

Surveillance LevelArnE-Related ComponentsImplementation Approach
Local/ClinicalPCR screening for arnE variantsIntegration into routine diagnostic workflows
RegionalPhenotypic-genotypic correlation studiesCollaborative networks between healthcare facilities
NationalDatabase of arnE sequences and associated MICsCentralized reference laboratory coordination
GlobalStandardized reporting of polymyxin resistance mechanismsIntegration with existing surveillance programs (GLASS, NARMS)

Recent research has already highlighted the importance of surveillance for LT1-producing E. fergusonii strains, particularly those with chromosomally integrated elt1 genes . A similar approach focusing on ArnE variants could help identify emerging resistance trends and guide antimicrobial stewardship efforts.

What interdisciplinary research approaches could advance our understanding of ArnE structure and function?

Advancing our understanding of ArnE requires interdisciplinary collaboration across multiple scientific fields:

Interdisciplinary Research Frameworks:

  • Structural Biology and Biophysics:

    • Cryo-EM studies of the ArnE-ArnF complex in different conformational states

    • Advanced spectroscopic techniques (solid-state NMR, EPR) for dynamic structural information

    • Neutron diffraction to identify water molecules in the transport pathway

    • Molecular dynamics simulations to model substrate translocation mechanisms

  • Chemical Biology Approaches:

    • Development of activity-based probes that covalently label active ArnE

    • Synthesis of substrate analogs with photoaffinity groups for binding site mapping

    • Click chemistry applications for in situ labeling of functional complexes

    • Unnatural amino acid incorporation to introduce biophysical probes at specific sites

  • Systems Biology Integration:

    • Multi-omics approaches linking genomic features to transcriptional and translational responses

    • Network modeling of resistance pathways to identify critical nodes

    • Flux balance analysis to quantify metabolic impacts of ArnE activity

    • Machine learning applications for phenotype prediction from sequence data

  • Translational Research Directions:

    • High-throughput screening platforms for ArnE inhibitor discovery

    • Animal models to assess in vivo efficacy of targeting ArnE

    • Clinical correlations between ArnE variants and treatment outcomes

    • Point-of-care diagnostic development for rapid resistance detection

Collaborative Research Model:

A comprehensive research program might include:

  • Structural biologists focusing on ArnE-ArnF complex architecture

  • Biochemists developing functional assays for flippase activity

  • Microbiologists characterizing resistance phenotypes in clinical isolates

  • Computational biologists modeling evolutionary trajectories and protein dynamics

  • Medicinal chemists designing potential inhibitors based on structural insights

  • Clinical researchers evaluating diagnostic and therapeutic applications

Such interdisciplinary collaboration would address the multifaceted challenges presented by this complex membrane protein system and accelerate progress toward practical applications in antimicrobial resistance management.

What are the most critical unanswered questions regarding E. fergusonii ArnE that should be prioritized by researchers?

Despite significant advances in our understanding of E. fergusonii and the ArnE protein, several critical questions remain unresolved and should be prioritized:

Priority Research Questions:

  • Structural Determinants of Function:

    • What is the high-resolution structure of the ArnE-ArnF complex?

    • Which amino acid residues are essential for substrate recognition and transport?

    • How does the protein complex undergo conformational changes during the transport cycle?

    • What is the stoichiometry and quaternary organization of the functional flippase?

  • Regulatory Mechanisms:

    • How do environmental signals modulate arnE expression beyond the known PmrA pathway?

    • Are there post-translational modifications that regulate ArnE activity?

    • Do small RNAs play a role in fine-tuning expression of the arn operon?

    • How do different stress responses coordinate with ArnE-mediated resistance?

  • Evolutionary and Ecological Considerations:

    • How has ArnE evolved differently across E. fergusonii lineages from various sources?

    • What is the fitness cost of maintaining functional ArnE in the absence of selection pressure?

    • How does horizontal gene transfer influence the distribution of arn operon variants?

    • What environmental reservoirs contribute to the dissemination of resistant E. fergusonii?

  • Clinical and Therapeutic Implications:

    • Can ArnE variants serve as predictive biomarkers for clinical outcomes?

    • How does ArnE-mediated resistance interact with other resistance mechanisms in vivo?

    • Is there potential for developing ArnE inhibitors as adjuvants to restore polymyxin sensitivity?

    • What surveillance strategies would be most effective for tracking ArnE-mediated resistance?

These research priorities recognize the interconnected nature of basic science investigations and their potential clinical applications, highlighting the need for both mechanistic studies and translational research efforts.

How should researchers design comprehensive experimental approaches to study the role of ArnE in emerging multidrug-resistant E. fergusonii?

A comprehensive research program investigating ArnE in multidrug-resistant E. fergusonii should employ a multi-tiered experimental design:

Tiered Experimental Framework:

Tier 1: Epidemiological and Genomic Characterization

  • Collect diverse E. fergusonii isolates from clinical, animal, and environmental sources

  • Perform whole-genome sequencing and comparative genomic analysis

  • Establish a database of arnE sequence variants, associated resistance phenotypes, and genetic context

  • Identify high-risk lineages showing multidrug resistance patterns

Tier 2: Mechanistic Studies

  • Generate isogenic mutants with specific modifications in arnE and related genes

  • Perform detailed phenotypic characterization under various stress conditions

  • Use transcriptomic and proteomic approaches to map regulatory networks

  • Develop in vitro reconstitution systems for functional studies

Tier 3: Structural and Biochemical Analysis

  • Purify and structurally characterize the ArnE-ArnF complex

  • Develop functional assays to measure flippase activity

  • Screen for small molecule modulators of ArnE function

  • Validate structure-function relationships through site-directed mutagenesis

Tier 4: Translational Applications

  • Evaluate diagnostic potential of ArnE-based detection methods

  • Test candidate inhibitors in relevant infection models

  • Develop surveillance tools for monitoring resistance trends

  • Formulate evidence-based recommendations for antimicrobial stewardship

Implementation Strategy:

Research PhaseKey ActivitiesExpected Outcomes
Initial (Year 1)Collect isolates, establish genomic database, develop basic assaysBaseline characterization of diversity and prevalence
Intermediate (Years 2-3)Functional characterization, regulatory analysis, preliminary structure studiesDetailed mechanistic understanding of ArnE function
Advanced (Years 3-5)High-resolution structural studies, inhibitor screening, in vivo validationIdentification of potential therapeutic targets
Translational (Years 4-5+)Diagnostic development, surveillance implementation, clinical correlation studiesPractical tools for managing ArnE-mediated resistance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.