Recombinant Escherichia fergusonii Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Description

Introduction

The ArnF protein, or Recombinant Escherichia fergusonii Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF, is a protein component derived from Escherichia fergusonii. It is categorized as a probable flippase subunit involved in the transport of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol . Flippases are enzymes that facilitate the movement of lipids or other molecules across biological membranes. ArnF is involved in modifying bacterial lipopolysaccharides (LPS), which are crucial for the bacterium's resistance to antimicrobial peptides .

Characteristics

CharacteristicDescription
SourceEscherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Product TypeRecombinant Protein
Purity>85% (SDS-PAGE)
Host CellMammalian cell
Alternative NamesL-Ara4N-phosphoundecaprenol flippase subunit ArnF, Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
UniProt No.B7LM72
Storage ConditionsLiquid form: 6 months at -20°C/-80°C. Lyophilized form: 12 months at -20°C/-80°C
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C .

Function and Role

ArnF is a subunit of the enzyme responsible for flipping or transferring 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol across the bacterial inner membrane . This process is essential for the modification of LPS with 4-amino-4-deoxy-L-arabinose (L-Ara4N), which enhances the bacterium's resistance to cationic antimicrobial peptides like polymyxin B and other host defense molecules . The modification of LPS is a key mechanism by which bacteria evade the host immune system .

Applications of Recombinant Proteins

Recombinant proteins, like ArnF, have numerous applications in biological research, drug development, and therapeutics . Some key applications include:

  • Expression Studies: Facilitating the production and analysis of specific proteins by inserting a gene of interest into a host organism .

  • Protein Purification: Simplifying the isolation and purification of proteins using affinity tags .

  • Functional Studies: Investigating the biological functions of proteins through overexpression or knockdown experiments .

  • Structural Biology: Understanding the three-dimensional structure of proteins via X-ray crystallography and NMR spectroscopy .

  • Drug Development: Screening potential drug candidates that interact with specific disease-associated proteins .

  • Vaccine Production: Producing vaccines using recombinant DNA technology .

  • Diagnostic Tools: Developing diagnostic tools like ELISA assays to detect antibodies or antigens .

  • Therapeutic Proteins: Serving as therapeutic agents, including hormones and clotting factors .

Protein Structure

Proteins have four levels of structure:

Research and Drug Development Applications

Recombinant ArnF can be utilized in several research and drug development areas :

  • Antimicrobial Resistance Studies: Investigating the mechanisms of bacterial resistance to antimicrobial peptides by studying the role of ArnF in LPS modification.

  • Drug Target Validation: Validating ArnF as a potential drug target for developing new antibacterial agents.

  • Structural Biology and Drug Design: Determining the crystal structure of ArnF to facilitate the design of inhibitors that block its function.

  • Diagnostic Assay Development: Developing diagnostic assays to detect E. fergusonii infections by using ArnF as an antigen.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
arnF; EFER_0910; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
arnF
Target Protein Sequence
MGLMWGLFSVIIASAAQLSLGYAASHLPPMTQFWDFIAAFFAFGPGARMLVVGLVGYLLS VFCWYKALHQLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF LPTTKQRY
Uniprot No.

Target Background

Function
This protein translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane, from the cytoplasm to the periplasm.
Database Links
Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ArnF protein in Escherichia fergusonii and what is its primary function?

ArnF (previously known as PmrL) is a protein subunit that forms part of a flippase complex responsible for transporting undecaprenyl phosphate-α-L-Ara4N across the inner membrane of Escherichia fergusonii. This transport mechanism is crucial for the modification of lipid A with 4-amino-4-deoxy-L-arabinose (L-Ara4N), which confers resistance to polymyxin and other cationic antimicrobial peptides. The ArnF subunit works in conjunction with ArnE (previously PmrM) to form an active flippase complex that facilitates this essential membrane transport process. When these genes are mutated or deleted, the bacterium becomes significantly more susceptible to antimicrobial compounds due to the inability to properly modify its lipopolysaccharide structure .

How does ArnF differ from other proteins in the L-arabinose modification pathway?

ArnF functions specifically as part of the flippase complex that transports the undecaprenyl phosphate-α-L-Ara4N molecule across the inner bacterial membrane, distinguishing it from other proteins in the L-Ara4N modification pathway that serve different functions. While ArnA catalyzes the oxidative decarboxylation of UDP-glucuronic acid and performs N-formylation, ArnB is involved in transamination, ArnC transfers the N-formylated L-Ara4N moiety to undecaprenyl phosphate, and ArnD deformylates this molecule. ArnT then transfers the L-Ara4N group to lipid A on the outer surface of the inner membrane. The ArnE/ArnF (PmrM/PmrL) complex is uniquely responsible for flipping the undecaprenyl phosphate-α-L-Ara4N molecule from the cytoplasmic to the periplasmic face of the inner membrane, making it accessible for the ArnT transferase . This distinct role makes ArnF an essential component in the complete pathway leading to antimicrobial peptide resistance.

What genomic characteristics are associated with the arnF gene in E. fergusonii?

The arnF gene in E. fergusonii is typically found within an operon containing other genes involved in the L-Ara4N modification pathway. This operon is regulated by the PhoPQ and PmrAB two-component systems, which respond to environmental signals including low Mg²⁺ concentrations and the presence of antimicrobial peptides. The gene itself exhibits high sequence conservation among Enterobacteriaceae, reflecting its critical function in bacterial survival under stress conditions. Analysis of E. fergusonii isolates shows that this species harbors diverse genetic elements, with varied arrangements of antimicrobial resistance genes. Pulsed-field gel electrophoresis (PFGE) studies have demonstrated that E. fergusonii isolates from different sources can be grouped into multiple genetic subclades, indicating significant genetic diversity within this species . The conservation of arnF across these diverse genetic backgrounds underscores its importance in bacterial physiology and antimicrobial resistance.

How does the ArnF subunit contribute to the flippase mechanism in transporting undecaprenyl phosphate-α-L-Ara4N?

The ArnF subunit functions as an integral component of the undecaprenyl phosphate-α-L-Ara4N flippase complex, facilitating the translocation of this lipid-linked precursor from the cytoplasmic to the periplasmic face of the inner membrane. Experimental evidence from labeling studies using membrane-impermeable reagents such as N-hydroxysulfosuccinimidobiotin demonstrates that mutations in arnF (pmrL) result in a 4-5 fold reduction in the periplasmic concentration of undecaprenyl phosphate-α-L-Ara4N . This indicates that ArnF directly contributes to the membrane flipping process. The protein likely forms a transmembrane channel or creates a hydrophilic environment that allows the polar head group of undecaprenyl phosphate-α-L-Ara4N to traverse the hydrophobic core of the lipid bilayer while keeping the lipid tail within the membrane. The flippase activity requires both ArnE and ArnF subunits, suggesting they form a heteromeric complex with complementary functions in substrate recognition, binding, and translocation across the membrane barrier .

What structural features of ArnF are critical for its function in antimicrobial resistance?

While detailed structural information specifically for E. fergusonii ArnF is limited, functional studies suggest several critical structural features necessary for its flippase activity. ArnF is predicted to contain multiple transmembrane domains that anchor it within the inner membrane and form the substrate translocation pathway. The protein likely possesses binding sites for undecaprenyl phosphate-α-L-Ara4N that recognize specific features of this substrate, ensuring selectivity in transport. Charged or polar amino acid residues within the transmembrane regions may facilitate the movement of the hydrophilic head group of undecaprenyl phosphate-α-L-Ara4N across the membrane. Additionally, protein-protein interaction domains enable ArnF to associate with ArnE to form the functional flippase complex. Mutational studies have shown that disruption of these structural features leads to a phenotypic switch from polymyxin-resistant to polymyxin-sensitive bacterial strains, demonstrating their critical importance in the resistance mechanism . The precise structural determinants and conformational changes involved in the flipping mechanism remain subjects for advanced structural biology investigations.

What evidence supports the role of ArnF in L-Ara4N modification of lipid A?

Several lines of experimental evidence firmly establish ArnF's role in L-Ara4N modification of lipid A. First, deletion mutations in the arnF (pmrL) gene result in a polymyxin-sensitive phenotype despite normal levels of undecaprenyl phosphate-α-L-Ara4N production, indicating a defect in the transport or utilization of this precursor . Second, biochemical analysis of lipid A from arnF mutants shows the absence of L-Ara4N modifications that are present in wild-type strains. Third, membrane labeling experiments with N-hydroxysulfosuccinimidobiotin demonstrate reduced periplasmic localization of undecaprenyl phosphate-α-L-Ara4N in arnF mutants, directly implicating this protein in the membrane translocation process . Fourth, comparative studies with arnT mutants (which lack the transferase enzyme but retain normal flippase function) show normal periplasmic distribution of undecaprenyl phosphate-α-L-Ara4N but no lipid A modification, distinguishing the roles of these proteins. Collectively, these findings provide strong evidence that ArnF functions specifically in the flippase-mediated transport of undecaprenyl phosphate-α-L-Ara4N to the periplasmic space, a prerequisite step for subsequent L-Ara4N transfer to lipid A by ArnT .

What are the recommended methods for cloning and expressing recombinant ArnF from E. fergusonii?

For successful cloning and expression of recombinant ArnF from E. fergusonii, researchers should consider a multi-step approach beginning with genomic DNA extraction followed by PCR amplification of the arnF gene using primers designed from conserved regions. The amplified gene should be inserted into an expression vector containing an appropriate promoter system (such as T7) and fusion tags (like His6 or MBP) to facilitate detection and purification. Expression in E. coli BL21(DE3) or C43(DE3) strains is recommended as these are optimized for membrane protein expression. Induction conditions should be carefully optimized, with lower temperatures (16-25°C) and reduced inducer concentrations often yielding better results for membrane proteins. For purification, detergent solubilization using mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin is crucial to maintain protein stability and function. Affinity chromatography followed by size exclusion chromatography can then be employed to obtain purified protein. Throughout this process, it's essential to verify protein expression and localization using Western blotting with antibodies against the fusion tag or ArnF-specific antibodies .

How can researchers effectively measure ArnF flippase activity in laboratory settings?

Measuring ArnF flippase activity requires specialized approaches that monitor the translocation of undecaprenyl phosphate-α-L-Ara4N across membranes. One effective method involves using membrane-impermeable labeling reagents such as N-hydroxysulfosuccinimidobiotin to quantify the amount of accessible substrate on the periplasmic face of the inner membrane. In this approach, bacterial cells or membrane vesicles are treated with the labeling reagent, followed by extraction and analysis of labeled lipids . Alternatively, researchers can establish reconstituted systems using purified components in artificial liposomes with fluorescently labeled substrate analogs, allowing real-time monitoring of flipping activity. Mass spectrometry-based approaches can quantify the relative abundance of modified lipid A species, providing an indirect measure of flippase activity. Antimicrobial susceptibility testing with polymyxin or other cationic peptides offers a functional readout of the entire pathway's activity. For more precise mechanistic studies, radioactively labeled substrates can be used in conjunction with quenched-flow techniques to determine kinetic parameters of the flipping process. These methodologies should be coupled with appropriate controls, including arnF deletion mutants and complementation studies, to establish specific contributions of the ArnF protein to the measured activity .

What strategies can be employed to study ArnF-ArnE protein interactions?

Investigating the interaction between ArnF and ArnE proteins requires approaches that can detect and characterize membrane protein complexes. Co-immunoprecipitation using antibodies against epitope tags fused to either protein can pull down intact complexes from solubilized membranes. Bacterial two-hybrid systems adapted for membrane proteins, such as BACTH (Bacterial Adenylate Cyclase Two-Hybrid), can identify interaction domains in vivo. For higher resolution analysis, crosslinking studies using chemical crosslinkers followed by mass spectrometry can identify specific contact points between the proteins. Förster resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) using fluorescent protein fusions can detect interactions in living cells and provide spatial information. Blue native PAGE can separate intact membrane protein complexes while preserving native interactions. Advanced structural biology techniques including cryo-electron microscopy or X-ray crystallography of the purified complex can provide atomic-level details of the interaction interface. Functional complementation studies using chimeric proteins or domain swapping between ArnF and ArnE can help identify regions essential for complex formation and activity. These approaches, used in combination, can provide comprehensive insights into how these two proteins interact to form a functional flippase complex .

What unique adaptations does E. fergusonii display in its arnF gene compared to E. coli?

E. fergusonii displays several notable adaptations in its arnF gene compared to the E. coli ortholog. Genomic analyses reveal slight variations in the promoter regions controlling arnF expression, potentially contributing to differences in regulation. E. fergusonii strains often show constitutive or elevated expression of arnF under standard laboratory conditions, whereas E. coli typically requires specific environmental triggers for expression. The coding sequence of arnF in E. fergusonii contains several non-synonymous mutations that may affect protein stability, substrate binding affinity, or interaction with ArnE. These genetic differences may contribute to the observation that some E. fergusonii isolates display higher baseline resistance to polymyxins than their E. coli counterparts. Additionally, horizontal gene transfer events appear to have influenced the evolution of arnF in E. fergusonii, as evidenced by mosaic gene structures in certain strains. E. fergusonii, being a prevalent species in food animals, has likely experienced different selective pressures compared to E. coli, potentially driving unique adaptations in antimicrobial resistance genes including arnF . These adaptations highlight the species-specific evolution of resistance mechanisms and underscore the importance of studying diverse bacterial species rather than focusing exclusively on model organisms.

How do modifications in the arn pathway affect antimicrobial resistance profiles across different bacterial species?

Modifications in the arn pathway significantly impact antimicrobial resistance profiles across bacterial species, with variations in pathway components leading to different resistance patterns. Species with complete and functional arn pathways typically exhibit high-level resistance to polymyxins and other cationic antimicrobial peptides, while those with alterations in key components show variable resistance levels. In E. fergusonii, studies have shown that strains with active arn pathways can display MIC values for colistin (polymyxin E) up to 4-8 times higher than strains with pathway defects . The pathway's efficiency also affects cross-resistance to other antimicrobials, as lipid A modifications can alter membrane permeability to various compounds.

Interestingly, some bacterial species have evolved alternative or complementary mechanisms of resistance that work alongside the arn pathway, creating more robust defense systems. The table below summarizes comparative resistance profiles across selected Enterobacteriaceae species with different arn pathway characteristics:

SpeciesArn Pathway StatusPolymyxin B MIC (μg/ml)Colistin MIC (μg/ml)Other Resistance Mechanisms
E. fergusonii (wild type)Complete8-164-8MCR-1 in 18.8% of isolates
E. fergusonii (arnF mutant)Defective0.5-20.25-1Variable
E. coli (wild type)Complete2-81-4Multiple mechanisms
S. enterica (wild type)Complete4-162-8PmrAB mutations common

These differences highlight the complex interplay between genetic components of the arn pathway and resulting antimicrobial resistance phenotypes across bacterial species .

What are the methodological challenges in studying recombinant ArnF protein structure and function?

Studying recombinant ArnF presents several methodological challenges due to its nature as an integral membrane protein. The hydrophobic character of ArnF makes it difficult to express, isolate, and purify in functional form without compromising its structural integrity. Researchers face issues with protein aggregation, misfolding, and low expression yields when attempting heterologous expression. The requirement for a lipid environment to maintain functionality further complicates in vitro studies. Standard structural determination techniques like X-ray crystallography are challenging due to difficulties in obtaining well-diffracting crystals of membrane proteins.

Additionally, the functional assessment of ArnF requires complex assay systems that can monitor lipid flipping across membranes, which are technically demanding and difficult to quantify. The fact that ArnF functions as part of a heteromeric complex with ArnE means that studying ArnF in isolation may not provide physiologically relevant insights. Reconstitution of the complete flippase system requires careful optimization of lipid composition, protein ratios, and buffer conditions. Furthermore, the substrate undecaprenyl phosphate-α-L-Ara4N is not commercially available and must be enzymatically synthesized, adding another layer of complexity to functional studies. These challenges necessitate innovative approaches combining genetics, biochemistry, and advanced biophysical techniques to elucidate the structure-function relationships of ArnF .

How might mutations in arnF impact antimicrobial resistance evolution in clinical settings?

Mutations in arnF can significantly influence antimicrobial resistance evolution in clinical settings through several mechanisms. Loss-of-function mutations typically result in increased susceptibility to polymyxins and other cationic antimicrobial peptides due to the inability to modify lipid A with L-Ara4N. Conversely, gain-of-function mutations or upregulation of arnF expression could enhance resistance by increasing the efficiency of undecaprenyl phosphate-α-L-Ara4N translocation. Clinical isolates of E. fergusonii have demonstrated variable polymyxin resistance profiles, suggesting ongoing evolutionary adaptation of the arn pathway components including arnF .

The co-occurrence of arnF mutations with other resistance determinants, such as mcr-1 (found in 18.8% of E. fergusonii isolates in one study), can create complex resistance phenotypes that may influence treatment outcomes . Selective pressure from antimicrobial use in both clinical and agricultural settings drives the evolution of the arn pathway, potentially leading to the emergence of highly resistant strains. The horizontal transfer potential of arnF and associated genes further complicates the resistance landscape, allowing rapid dissemination of resistance mechanisms between bacterial species and strains. Monitoring arnF mutations in clinical isolates could provide early warning of emerging resistance trends and inform antimicrobial stewardship efforts. Understanding the evolutionary dynamics of arnF mutations is therefore crucial for predicting and managing antimicrobial resistance in clinical settings.

What novel therapeutic approaches might target the ArnF-mediated lipid A modification pathway?

Novel therapeutic approaches targeting the ArnF-mediated lipid A modification pathway represent promising strategies for combating antimicrobial resistance. Small molecule inhibitors designed to specifically bind to ArnF or disrupt the ArnE-ArnF interaction could prevent flippase function, thereby blocking L-Ara4N addition to lipid A and restoring bacterial susceptibility to polymyxins and host antimicrobial peptides. Structure-based drug design, once detailed structural information becomes available, could enable the development of highly specific inhibitors with minimal off-target effects. Peptide-based therapeutics mimicking natural substrates could competitively inhibit the flippase complex, while CRISPR-Cas antimicrobials targeting the arnF gene could provide a genetic approach to disabling this resistance mechanism.

Combination therapies pairing polymyxins with arn pathway inhibitors could revitalize the effectiveness of these important last-line antibiotics. Nanoparticle-based delivery systems might enable targeted delivery of inhibitors to sites of infection while overcoming membrane barriers. Alternative approaches include developing compounds that exploit the altered membrane properties of bacteria utilizing the L-Ara4N pathway, essentially turning this resistance mechanism into a vulnerability. Immunomodulatory strategies enhancing host antimicrobial peptide production could synergize with arn pathway inhibition. Each of these approaches requires rigorous validation in appropriate model systems before clinical application, but they collectively represent promising directions for addressing the critical challenge of antimicrobial resistance .

What is the prevalence of functional arnF genes in clinical and environmental E. fergusonii isolates?

Research indicates substantial variation in the prevalence of functional arnF genes across different E. fergusonii populations. A comprehensive study of 1,400 samples from food animals in China identified 133 E. fergusonii isolates (9.5% prevalence), with genetic analysis revealing that the vast majority possessed intact arnF genes capable of contributing to antimicrobial resistance . These isolates could be grouped into 41 different PFGE subclades, indicating significant genetic diversity within the species. The functionality of the arnF gene appears to correlate strongly with antimicrobial resistance profiles, particularly resistance to polymyxin antibiotics. Clinical isolates tend to show higher rates of functional arnF genes compared to environmental samples, likely reflecting selective pressure from antimicrobial exposure in clinical settings.

Geographical variation is also evident, with higher rates of functional arnF genes reported in regions with greater antimicrobial use in agriculture and medicine. Interestingly, the co-occurrence of arnF with other resistance determinants, particularly mcr-1 (found in 18.8% of E. fergusonii isolates in one study), suggests complex evolutionary dynamics shaping resistance profiles . These patterns underscore the importance of surveillance programs monitoring the prevalence and functionality of arnF genes in diverse E. fergusonii populations as indicators of emerging resistance trends and potential reservoirs of resistance determinants.

How does experimental manipulation of arnF expression affect antimicrobial susceptibility patterns?

Experimental manipulation of arnF expression produces predictable and significant changes in antimicrobial susceptibility patterns, providing clear evidence of its role in resistance mechanisms. Deletion of arnF consistently results in increased susceptibility to polymyxins and other cationic antimicrobial peptides, with minimum inhibitory concentration (MIC) values typically decreasing 4-8 fold compared to wild-type strains . This phenotypic change occurs despite normal levels of undecaprenyl phosphate-α-L-Ara4N production, confirming that the susceptibility is specifically due to impaired translocation of this precursor across the inner membrane.

Conversely, overexpression of arnF from plasmid-based systems can enhance resistance levels, although this effect is often moderate unless accompanied by corresponding increases in other arn pathway components. Complementation studies in arnF deletion mutants restore resistance to near wild-type levels, confirming the direct relationship between arnF function and antimicrobial resistance. Site-directed mutagenesis of conserved residues in arnF provides insights into structure-function relationships, with mutations in predicted transmembrane domains typically causing the most dramatic susceptibility changes. Time-kill assays reveal that arnF-deficient strains not only have lower MIC values but also exhibit more rapid killing kinetics when exposed to polymyxins, highlighting the protective role of ArnF-mediated lipid A modifications against the membrane-disruptive effects of these antibiotics .

What recent advances have been made in understanding the regulation of arnF expression in response to environmental stimuli?

Recent advances in understanding arnF regulation reveal sophisticated control mechanisms responding to diverse environmental stimuli. The arnF gene, as part of the arn operon, is primarily regulated by the PhoPQ and PmrAB two-component systems that sense environmental signals including low Mg²⁺ concentrations, acidic pH, and the presence of antimicrobial peptides. New research has identified additional regulatory factors including small RNAs that fine-tune arnF expression post-transcriptionally. Of particular interest, studies in E. fergusonii have identified a small RNA (MgrR) containing a unique 53 bp insertion (a repetitive extragenic palindromic sequence) that nevertheless remains functional and influences oxidative stress responses, potentially intersecting with arn pathway regulation .

Epigenetic mechanisms involving DNA methylation patterns have been shown to influence the accessibility of arn operon promoters to transcription factors. Proteomic studies have identified new protein-protein interactions affecting PmrA activity and consequently arnF expression. Metabolomic approaches have revealed that specific metabolic states and intermediates can influence arn operon expression independently of known two-component systems. Environmental conditions typical of host niches, including oxygen limitation and specific nutrient profiles, have been shown to modulate arnF expression through previously unrecognized pathways. These advances collectively paint a picture of arnF regulation as a complex network responsive to multiple environmental inputs, allowing bacteria to fine-tune their antimicrobial resistance profile according to specific environmental challenges .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.