Recombinant Escherichia fergusonii Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Escherichia fergusonii YciB is a 179-amino-acid protein (UniProt ID: B7MU42) expressed in E. coli with an N-terminal His tag for purification . It belongs to the YciB protein family, which is implicated in cell envelope integrity and septation processes in Enterobacteriaceae . While functional data primarily derive from E. coli homologs, this recombinant variant enables targeted studies in E. fergusonii.

Key Features

PropertyDetails
HostEscherichia coli (expression system)
TagN-terminal His tag
Molecular Weight~20 kDa (calculated)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Role in Cell Envelope Integrity

In E. coli, YciB synergizes with DcrB to maintain membrane stability. Deletion of both proteins causes:

  • Lipopolysaccharide accumulation

  • Membrane vesiculation

  • Lethal inner membrane-peptidoglycan linkages .

Septation and Division

YciB interacts with ZipA, a key cell division protein, influencing septum localization. Overexpression elongates cells, while deletion shortens them .

Mechanistic Studies

  • Investigating septation and membrane dynamics in E. fergusonii .

  • Protein-protein interaction assays (e.g., with ZipA homologs) .

Technical Uses

  • Antigen for ELISA development .

  • Structural biology (e.g., crystallography or NMR) .

Recombinant Production

ParameterDetails
Expression VectorE. coli-optimized plasmid
PurificationImmobilized metal affinity chromatography (IMAC)
ReconstitutionSterile deionized water (0.1–1.0 mg/mL) with glycerol for stability
StabilityStore at -20°C/-80°C; avoid freeze-thaw cycles

Future Directions

  • Functional Validation: Direct studies on E. fergusonii YciB’s role in antibiotic resistance or biofilm formation .

  • Structural Analysis: Cryo-EM or X-ray crystallography to resolve membrane-spanning domains .

  • Interactome Mapping: Identification of binding partners in E. fergusonii .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method or location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it.
Synonyms
yciB; EFER_1700; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELSLPQPVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQDDKS
Uniprot No.

Target Background

Function
This protein plays a role in cell envelope biogenesis, maintenance of cell envelope integrity, and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Escherichia fergusonii and how does it differ from closely related Escherichia coli?

Escherichia fergusonii is a gram-negative bacterium belonging to the genus Escherichia that has emerged as an increasingly important pathogen in recent years. While E. fergusonii shares significant genomic similarity with E. coli, these species cannot be reliably distinguished using 16S rRNA gene sequences alone due to their close evolutionary relationship. Phylogenetic analysis based on whole-genome sequencing reveals distinctive lineages between these species . The most reliable differentiation method utilizes adenylate kinase (adk) housekeeping gene analysis from the E. coli multi-locus sequence typing scheme, which contains four specific loci that discriminate between these species . E. fergusonii has been isolated from various sources including farm environments, animal feces, and human clinical samples, with increasing reports of pathogenic potential .

What are the challenges in molecular identification of E. fergusonii in experimental settings?

The primary challenge in E. fergusonii identification stems from its close genetic relationship with E. coli. Traditional approaches using 16S rRNA gene sequencing fail to provide clear species delineation due to high sequence conservation. Researchers should implement a multi-faceted identification protocol:

  • Initial screening using MALDI-TOF/MS for preliminary identification

  • Confirmation through adk gene sequencing, focusing on the four discriminatory nucleotide positions

  • Whole-genome sequencing for definitive characterization in research contexts

Studies have demonstrated that 83 isolates from disease-associated fecal samples initially identified as E. fergusonii showed distinct colonization patterns in patients with inflammatory bowel conditions . For accurate species determination, researchers should avoid relying solely on biochemical tests or 16S rRNA sequencing.

What expression systems are most suitable for recombinant production of E. fergusonii yciB?

For optimal expression of membrane proteins like yciB, researchers should consider:

  • Vector selection: pET-based systems with T7 promoters offer strong expression control

  • Host strains: C41(DE3) or C43(DE3) E. coli strains engineered for membrane protein expression

  • Fusion tags: N-terminal His-tags facilitate purification while minimizing interference with membrane insertion

  • Expression conditions: Lower temperature induction (16-20°C) and reduced IPTG concentrations (0.1-0.5mM) to prevent inclusion body formation

  • Membrane extraction: Careful detergent selection for solubilization (typically DDM or LDAO)

Based on successful approaches with homologous proteins, expressing the full-length protein (1-179 amino acids) with an N-terminal His-tag provides a basis for purification and characterization . The resulting recombinant protein should be stored as a lyophilized powder and reconstituted in appropriate buffers containing stabilizers like trehalose.

What purification strategy offers optimal yield and purity for recombinant yciB protein?

The most effective purification workflow for His-tagged yciB protein involves:

  • Cell lysis: Mechanical disruption (sonication or French press) in buffer containing 50mM Tris-HCl pH 8.0, 300mM NaCl, 10% glycerol, and protease inhibitors

  • Membrane isolation: Ultracentrifugation (100,000×g, 1 hour) to separate membrane fraction

  • Solubilization: Gentle solubilization with 1% n-dodecyl-β-D-maltoside (DDM) for 2 hours at 4°C

  • Affinity purification: IMAC using Ni-NTA resin with gradient elution (20-500mM imidazole)

  • Secondary purification: Size exclusion chromatography in buffer containing 0.05% DDM

  • Quality control: SDS-PAGE, Western blotting, and mass spectrometry verification

Expected yields from E. coli expression systems range from 1-5mg per liter of culture, with purity exceeding 90% after the complete purification process . For optimal stability, the purified protein should be stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

Storage ParameterRecommendationNotes
Physical formLyophilized powderProvides maximum stability
Storage temperature-20°C/-80°CAliquoting necessary for multiple use
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Brief centrifugation prior to opening
Long-term storageAdd 5-50% glycerolDefault recommendation: 50% final glycerol concentration
Working solution4°C for up to one weekAvoid repeated freeze-thaw cycles

How can researchers verify the proper folding and functionality of purified yciB protein?

Verifying the structural integrity and function of membrane proteins like yciB requires multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy: To assess secondary structure content and proper folding

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS): To confirm monodispersity and proper oligomeric state

  • Thermal shift assays: To evaluate protein stability under various conditions

  • Reconstitution into liposomes: To test functional parameters in a membrane environment

  • Binding assays: To verify interactions with known septation protein partners

The most direct functional assessment would involve complementation studies in yciB-deficient bacterial strains, measuring restoration of normal septation and cell division processes. Additionally, localization studies using fluorescently-tagged versions can confirm proper membrane targeting.

How conserved is the yciB gene across E. fergusonii strains compared to other Escherichia species?

While specific conservation data for yciB across E. fergusonii strains is not explicitly provided in the available literature, phylogenetic analysis methods used for core genome comparison can be applied to analyze this specific gene. Core genome analysis of 115 E. fergusonii strains has revealed distinct phylogenetic clustering patterns based on geographical origin, isolation source, and collection date . This analytical framework can be extended to examine the conservation of individual genes like yciB.

For a rigorous comparative analysis, researchers should:

  • Extract yciB gene sequences from available E. fergusonii genome assemblies

  • Perform multiple sequence alignment using MUSCLE or CLUSTAL algorithms

  • Calculate percent identity and identify variable regions

  • Construct maximum likelihood phylogenetic trees

  • Compare with homologs from other Escherichia species to identify species-specific signatures

Such analysis is particularly relevant given E. fergusonii's emerging role as a pathogen and the potential functional importance of septation proteins in bacterial adaptation and antimicrobial resistance mechanisms.

What bioinformatic approaches can predict functional domains and interactions of yciB in E. fergusonii?

Advanced bioinformatic analysis of yciB should incorporate:

  • Transmembrane topology prediction: TMHMM and Phobius tools to identify membrane-spanning regions

  • Conserved domain analysis: InterProScan and PFAM searches to identify functional motifs

  • Structural modeling: AlphaFold2 or I-TASSER to generate 3D structural predictions

  • Protein-protein interaction prediction: STRING database analysis supplemented with bacterial two-hybrid data

  • Genomic context analysis: Examination of neighboring genes and operonic structure across Escherichia species

Integration of these analyses provides a foundation for experimental validation, particularly for identifying key functional residues and potential interaction partners within the septation machinery. This is especially valuable for understudied organisms like E. fergusonii where direct experimental data may be limited.

How can CRISPR-Cas9 gene editing be optimized for studying yciB function in E. fergusonii?

CRISPR-Cas9 approaches for E. fergusonii require careful optimization due to its genetic distinctiveness from model organisms:

  • Guide RNA design: Select target sequences unique to yciB while avoiding off-target sites in the E. fergusonii genome

  • Delivery method: Optimize transformation protocols specifically for E. fergusonii clinical or environmental isolates

  • Editing strategy options:

    • Complete gene knockout to assess essentiality and loss-of-function phenotypes

    • Precise point mutations to analyze functionally critical residues

    • In-frame fluorescent protein fusions for localization studies

  • Screening method: Develop PCR-based or phenotypic screening approaches to identify successful edits

  • Complementation controls: Include plasmid-based complementation to verify phenotype specificity

The resulting mutant strains allow for detailed investigation of yciB function in native E. fergusonii genomic context, providing insights into its role in septation, cell division, and potentially antimicrobial resistance or virulence.

What cryo-electron microscopy approaches are most appropriate for structural characterization of yciB protein?

Cryo-EM studies of membrane proteins like yciB should employ:

  • Sample preparation options:

    • Detergent micelles: Using mild detergents like DDM or LMNG

    • Nanodiscs: Reconstitution into MSP1D1 scaffold protein discs with E. coli lipids

    • Amphipols: A8-35 amphipathic polymers for enhanced stability

  • Data collection parameters:

    • 300kV microscope with direct electron detector

    • Defocus range of -1.0 to -2.5 μm

    • 30-40 frames per exposure with motion correction

  • Processing workflow:

    • CTF estimation and correction

    • Particle picking and 2D classification

    • Ab initio 3D model generation and refinement

    • Post-processing with local resolution estimation

For contextual studies of yciB in the septation machinery, cryo-electron tomography of bacterial cells during division can provide complementary structural information about native protein arrangement and interactions.

What methods can elucidate yciB's precise role in bacterial cell division?

A comprehensive investigation of yciB's function in cell division should incorporate:

  • Fluorescent protein fusions: C-terminal or N-terminal fusions to track localization during the division cycle

  • Depletion studies: Inducible expression systems to create conditional knockdowns and observe division defects

  • Time-lapse microscopy: High-resolution imaging to monitor septation dynamics in wild-type versus mutant cells

  • Interaction mapping: Bacterial two-hybrid or co-immunoprecipitation to identify division machinery partners

  • Super-resolution microscopy: PALM or STORM imaging to resolve nanoscale organization at the division site

These approaches should be performed in parallel with careful phenotypic characterization of growth rates, cell morphology, and sensitivity to cell wall-targeting antibiotics. Integration of these datasets can position yciB within the complex network of proteins that orchestrate bacterial cytokinesis.

How might yciB function relate to antimicrobial resistance mechanisms in E. fergusonii?

The potential relationship between septation proteins and antimicrobial resistance warrants investigation, particularly given the rising prevalence of resistant E. fergusonii strains . Research approaches should include:

  • Comparative expression analysis: Quantitative PCR or RNA-seq comparing yciB expression in susceptible versus resistant isolates

  • Mutation studies: Assessment of whether yciB mutations affect minimum inhibitory concentrations (MICs) for various antibiotics

  • Drug interaction studies: Analysis of septation protein inhibitors in combination with conventional antibiotics

  • Membrane permeability assays: Evaluation of whether yciB alterations affect uptake of antibiotics

  • Cell wall synthesis interaction: Investigation of potential crosstalk between septation and peptidoglycan synthesis pathways

This research direction is particularly relevant given that E. fergusonii isolates have been found harboring mobile colistin resistance (mcr-1) genes and other antimicrobial resistance determinants . Understanding how core cellular processes like septation intersect with resistance mechanisms could identify novel therapeutic targets.

How can comparative studies of yciB contribute to understanding E. fergusonii pathogenesis?

Comparative analysis of yciB across pathogenic and non-pathogenic isolates can provide insights into E. fergusonii virulence through:

  • Sequence variation analysis: Identification of polymorphisms correlating with clinical versus environmental isolates

  • Expression profiling: Quantification of yciB expression under infection-relevant conditions

  • Host-pathogen interaction models: Assessment of yciB mutant behavior in tissue culture or animal infection models

  • Cross-species comparison: Functional comparison with yciB homologs in established pathogens

  • Evolutionary analysis: Identification of selection signatures suggesting adaptation to host environments

This research framework is particularly relevant given E. fergusonii's increased detection in clinical settings and emerging significance as a pathogen . The ability of E. fergusonii to cause infections in various tissues suggests potential adaptations in core cellular processes that facilitate pathogenesis.

What methodology is optimal for investigating interactions between yciB and the mcr-1 colistin resistance mechanism?

Given the detection of mcr-1 plasmids in E. fergusonii isolates , potential interactions between septation proteins and colistin resistance mechanisms represent an important research direction. Methodological approaches should include:

  • Co-expression analysis: Evaluation of whether mcr-1 expression affects yciB levels and localization

  • Membrane composition studies: Assessment of how mcr-1-mediated lipid A modifications affect membrane protein function

  • Genetic interaction screens: Identification of synthetic phenotypes between yciB variants and mcr-1

  • Structural biology approaches: Investigation of potential physical interactions between these membrane-associated systems

  • Physiological impact assessment: Determination of whether mcr-1 expression alters septation dynamics

The plasmid p5ZF15-2-1 carrying mcr-1 in E. fergusonii has been characterized as an IncI2 type plasmid of 61,228 bp with 75 CDSs . Understanding how such mobile genetic elements interact with core cellular processes like septation could provide insights into both the evolution of resistance and potential targeted intervention strategies.

What emerging technologies hold promise for advancing E. fergusonii septation protein research?

Several cutting-edge technologies show particular promise for elucidating yciB function:

  • Single-molecule tracking: To monitor real-time dynamics of individual yciB molecules during cell division

  • CryoAPEX proximity labeling: For nanoscale mapping of protein neighborhoods in the division machinery

  • Microfluidics-based long-term imaging: For tracking septation processes across multiple generations

  • AlphaFold-enabled structural biology: For improved modeling of membrane protein structures and complexes

  • Native mass spectrometry: For analyzing intact membrane protein complexes and stoichiometry

Integration of these approaches with established methods can overcome current limitations in understanding membrane protein function in non-model organisms like E. fergusonii, potentially revealing unique adaptations compared to well-studied E. coli systems.

How might systems biology approaches integrate yciB function within broader cellular networks?

Systems-level investigation of yciB requires:

  • Interactome mapping: Comprehensive identification of interaction partners using proximity labeling approaches

  • Multi-omics integration: Correlation of proteomics, transcriptomics, and metabolomics data in wild-type versus mutant strains

  • Network perturbation analysis: Systematic disruption of potential interacting pathways

  • Computational modeling: In silico representation of septation dynamics incorporating experimental constraints

  • Evolutionary systems biology: Comparative analysis of septation networks across Escherichia species

Such holistic approaches can position yciB within the broader cellular context, revealing not only its direct role in septation but also potential connections to other processes including stress response, environmental adaptation, and antimicrobial resistance mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.