Recombinant Escherichia fergusonii Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Functional Role of Lgt in Lipoprotein Biosynthesis

Lgt catalyzes the transfer of a diacylglyceryl group from phosphatidylglycerol (PG) to the invariant cysteine in the lipobox motif (LXXC) of prolipoproteins, initiating lipoprotein maturation. This modification is critical for membrane integrity, virulence, and antibiotic resistance in Gram-negative bacteria .

Key Steps in Lipoprotein Maturation

StepEnzymeModification
1LgtDiacylglyceryl transfer (diacylation)
2LspAPhosphatidylethanolamine transfer (triacylation)
3LntN-acyltransferase activity (triacylation in Proteobacteria)

Membrane Topology and Conservation

  • E. coli Lgt is a 291-amino-acid, 33-kDa inner membrane protein with seven transmembrane (TM) helices .

  • The N-terminus faces the periplasm, while the C-terminus is cytoplasmic .

  • A conserved "Lgt signature motif" (Y26, N146, G154) is essential for catalysis .

Critical Residues

ResiduePositionFunction
Y26TM1Substrate binding
R143TM4Catalytic activity
E151TM4Stabilization of PG binding
R239TM6PG interaction
E243TM6Catalytic mechanism

Mutagenesis studies in E. coli revealed that Y26, N146, and G154 are indispensable for activity, while R143, E151, R239, and E243 are critical for substrate recognition .

Catalytic Mechanism and Substrate Specificity

Lgt binds PG via two distinct sites in its central cavity, enabling lateral substrate access through membrane clefts . The enzyme’s active site faces the periplasm, where PG’s head group interacts with conserved residues like R143 .

Proposed Mechanism

  1. PG binds to the Lgt active site via electrostatic interactions.

  2. The diacylglyceryl group is transferred to the lipobox cysteine, forming a thioester intermediate.

  3. Substrate release occurs through lateral exits in the membrane .

Inhibitor Research and Therapeutic Potential

Lgt inhibitors, such as macrocycles G2823 and G2824, show potent in vitro activity (IC₅₀: 0.18–0.93 μM) and bactericidal effects against E. coli and Acinetobacter baumannii . These inhibitors disrupt membrane integrity and outer membrane function, highlighting Lgt’s role in bacterial survival .

Key Findings on Inhibitors

InhibitorTargetIC₅₀ (μM)Bactericidal Effect
G2823Lgt0.93E. coli, A. baumannii
G2824Lgt0.18E. coli, A. baumannii

Genomic and Evolutionary Context in Escherichia fergusonii

  • High AMR Potential: Avian E. fergusonii strains harbor multiple antimicrobial resistance genes (e.g., CTX-M β-lactamases, mcr-1) .

  • Open Pan-Genome: Indicates ongoing adaptation and gene acquisition, potentially including Lgt-related virulence factors .

Phylogenetic Clustering
Indian E. fergusonii isolates cluster with Chinese and Australian strains, suggesting geographic dissemination .

Gaps and Future Directions

  1. Recombinant E. fergusonii Lgt: No commercial recombinant E. fergusonii Lgt is documented, unlike E. coli Lgt .

  2. Structural Studies: Crystallography or cryo-EM data for E. fergusonii Lgt are lacking.

  3. Inhibitor Resistance: Potential for efflux pumps (e.g., AcrAB-TolC) to confer resistance to Lgt inhibitors remains unexplored .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; EFER_2761; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPQFLDDPLYLFRVWDGGMSFHGGLIGVIVVMFIFAHRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of prolipoprotein diacylglyceryl transferase (Lgt) in E. fergusonii?

Prolipoprotein diacylglyceryl transferase (Lgt) in E. fergusonii catalyzes the first reaction in the three-step post-translational lipid modification pathway of bacterial lipoproteins. Specifically, Lgt transfers a diacylglyceryl group from phosphatidylglycerol to the sulfhydryl side chain of the invariant cysteine residue (Cys+1) in the conserved lipobox motif of preprolipoproteins as they exit the Sec or Tat translocon . This modification converts preprolipoproteins to prolipoproteins, which are subsequently processed by lipoprotein signal peptidase (LspA) that cleaves the signal peptide, liberating the α-amino group of Cys+1 . This lipid modification is crucial for proper anchoring of lipoproteins to the bacterial membrane, thereby affecting membrane integrity, protein localization, and various cellular functions .

How does E. fergusonii Lgt differ structurally from other Escherichia species?

While the crystal structure of E. fergusonii Lgt has not been specifically determined, comparative analysis with the closely related E. coli Lgt provides valuable insights. E. coli Lgt structures reveal two binding sites and critical residues including Arg143 and Arg239 that are essential for diacylglyceryl transfer . E. fergusonii Lgt likely shares high structural homology with E. coli Lgt but may exhibit subtle variations in substrate binding pockets or catalytic domains that could affect enzyme kinetics or substrate specificity.

What are the key domains and motifs in E. fergusonii Lgt essential for its activity?

The E. fergusonii Lgt protein, like its E. coli homolog, contains several critical domains and motifs that are essential for its enzymatic activity:

  • Prolipoprotein diacylglyceryl transferase signature (PS01311) - This highly conserved motif is characteristic of all Lgt proteins and essential for catalytic function .

  • Transmembrane domains - As an integral membrane protein, E. fergusonii Lgt contains multiple transmembrane regions that anchor the enzyme to the cytoplasmic membrane, positioning it to interact with both the lipid substrate (phosphatidylglycerol) and the emerging preprolipoprotein substrate.

  • Substrate binding pockets - Based on E. coli Lgt structures, two distinct binding sites have been identified—one for the phospholipid substrate and another for the preprolipoprotein .

  • Critical arginine residues - Residues corresponding to Arg143 and Arg239 in E. coli Lgt are likely essential in E. fergusonii Lgt as well, as complementation studies have demonstrated these residues are crucial for diacylglyceryl transfer activity .

The catalytic mechanism involves lateral entry and exit of substrates and products relative to the lipid bilayer, suggesting the presence of lateral access channels within the protein structure .

What are the most effective methods for isolating E. fergusonii from environmental or clinical samples?

Isolation of E. fergusonii from environmental or clinical samples requires specific methodological approaches to differentiate it from closely related species, particularly E. coli. The following protocol has demonstrated high sensitivity and specificity:

Step-by-step isolation protocol:

  • Primary enrichment culture: Inoculate samples into selective enrichment media such as MacConkey broth or EC broth and incubate at 37°C for 18-24 hours.

  • Selective plating: Streak the enriched samples onto differential and selective media such as MacConkey agar, EMB agar, or CHROMagar. E. fergusonii typically produces colorless colonies on MacConkey agar due to its inability to ferment lactose .

  • Biochemical screening: Select colonies for presumptive identification using biochemical tests. E. fergusonii is generally adonitol-positive and lactose-negative, although these characteristics alone are insufficient for definitive identification .

  • Molecular confirmation: Perform multiplex PCR targeting species-specific regions such as the 575bp region of the palmitoleoyl-acyl carrier protein (ACP)-dependent acyltransferase (EFER_0790) unique to E. fergusonii .

  • Sequence confirmation: Verify species identification using Sanger sequencing of the 16S rRNA gene or whole genome sequencing for definitive identification .

This integrated approach overcomes the limitations of phenotypic testing alone, which can misidentify E. fergusonii as E. coli, as observed in a study where all presumptive E. fergusonii isolates were incorrectly identified as E. coli by the API 20E identification kit .

What is the optimal expression system for producing recombinant E. fergusonii Lgt?

The optimal expression system for recombinant E. fergusonii Lgt must address several challenges inherent to membrane protein expression. Based on successful approaches with homologous proteins, the following system is recommended:

Expression host: E. coli BL21(DE3) or C41(DE3) strains are preferred for membrane protein expression. C41(DE3), a derivative of BL21(DE3), is particularly suitable for toxic membrane proteins as it contains mutations that prevent cell death associated with overexpression of membrane proteins.

Expression vector: pET series vectors (particularly pET28a) with an N-terminal His6-tag facilitate purification while minimizing interference with membrane insertion. The inclusion of a TEV protease cleavage site allows tag removal if necessary for functional studies.

Induction conditions: Low-temperature induction (16-20°C) with reduced IPTG concentration (0.1-0.5 mM) over extended periods (16-20 hours) maximizes proper folding and membrane insertion while minimizing the formation of inclusion bodies.

Membrane fraction isolation: Gentle lysis methods using lysozyme treatment followed by mechanical disruption (French press or sonication) in buffer containing stabilizing agents (glycerol, specific detergents) preserve protein structure and activity.

Detergent solubilization: n-Dodecyl β-D-maltoside (DDM) or n-Decyl-β-D-Maltopyranoside (DM) at concentrations just above critical micelle concentration effectively solubilize Lgt while maintaining enzymatic activity.

This expression system balances protein yield with proper folding and membrane insertion, critical factors for obtaining functional recombinant E. fergusonii Lgt for structural and biochemical studies.

How can researchers verify the functional activity of recombinant E. fergusonii Lgt?

Verifying the functional activity of recombinant E. fergusonii Lgt requires assays that detect its diacylglyceryl transferase activity. Based on established protocols for related Lgt proteins, the following methods are recommended:

1. GFP-based in vitro assay:
This assay monitors the transfer of diacylglyceryl from phosphatidylglycerol to a model preprolipoprotein substrate. A GFP-tagged preprolipoprotein substrate containing the conserved lipobox motif can be used to visualize and quantify the lipid transfer reaction . The lipidation causes a mobility shift that can be detected by SDS-PAGE and Western blotting.

2. Complementation assay:
This approach tests whether recombinant E. fergusonii Lgt can restore function in an lgt-knockout strain. Since lgt deletion is lethal in most Gram-negative bacteria, this assay typically uses conditional mutants or species where lgt is not essential (such as C. glutamicum) . Successful complementation confirms functional activity of the recombinant enzyme.

3. In vitro radiolabeling assay:
This definitive assay uses radiolabeled phosphatidylglycerol ([³H] or [¹⁴C]) as the lipid donor and a synthetic peptide containing the lipobox motif as the acceptor. The transfer of radiolabeled diacylglyceryl to the peptide substrate can be quantified by scintillation counting after separation by thin-layer chromatography or HPLC.

4. Mass spectrometry analysis:
LC-MS/MS analysis of reaction products can definitively confirm the addition of diacylglyceryl to the cysteine residue of the substrate peptide, providing both qualitative and quantitative assessment of enzymatic activity.

These complementary approaches provide robust verification of recombinant E. fergusonii Lgt functionality, essential for downstream structural and biochemical investigations.

What crystallization techniques have been successful for determining the structure of Lgt proteins?

Crystallization of membrane proteins like Lgt presents significant challenges due to their hydrophobic nature and requirement for detergents or lipid environments. Based on the successful crystallization of E. coli Lgt , the following techniques are recommended for E. fergusonii Lgt:

1. Protein purification optimization:

  • Use a two-step purification process: immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography

  • Maintain protein stability with specific detergents (DDM, DM, or LDAO) throughout purification

  • Include stabilizing additives such as glycerol (10-15%) and appropriate salt concentrations (150-300 mM NaCl)

2. Lipidic cubic phase (LCP) crystallization:
This method has proven particularly successful for membrane proteins:

  • Mix purified protein with monoolein at a ratio of 2:3 (w/w) using coupled syringes

  • Set up crystallization trials with various precipitants including PEG 400, PEG 4000, and ammonium sulfate

  • Screen pH ranges from 5.5 to 8.5 and temperatures from 4-22°C

3. In meso crystallization with ligands:

  • Co-crystallize with natural substrates (phosphatidylglycerol) or inhibitors (palmitic acid) to stabilize protein conformation

  • Use lipid analogues with shorter acyl chains to improve crystal packing

4. Bicelle crystallization:

  • Prepare bicelles using DMPC and CHAPSO at 2.8:1 ratio

  • Mix protein-detergent complex with bicelles at various ratios (1:2, 1:3, 1:4)

  • Incubate at low temperatures before setting up crystallization trials

5. Data collection considerations:

  • Use synchrotron radiation with microfocus beamlines for small crystals

  • Collect data at cryogenic temperatures (100K) after careful optimization of cryoprotectants

  • Consider serial crystallography approaches for microcrystals

These techniques should be applied systematically with extensive screening to identify conditions yielding diffraction-quality crystals of E. fergusonii Lgt.

The catalytic mechanism of E. fergusonii Lgt, inferred from structural and biochemical data on the homologous E. coli enzyme, involves a series of coordinated steps facilitating the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine in preprolipoproteins. The proposed mechanism proceeds as follows:

Step 1: Substrate binding and positioning

  • Phosphatidylglycerol enters the enzyme laterally from the membrane bilayer and binds to a specific pocket formed by transmembrane helices

  • The preprolipoprotein substrate, emerging from the Sec or Tat translocon, is recognized by its lipobox motif and positioned with the target cysteine residue in proximity to the bound phosphatidylglycerol

  • Critical arginine residues (R143 and R239) electrostatically interact with the phosphate group of phosphatidylglycerol, properly orienting it for nucleophilic attack

Step 2: Nucleophilic attack and thioether bond formation

  • The thiol group of the cysteine residue in the preprolipoprotein acts as a nucleophile, attacking the ester bond at the sn-1 position of phosphatidylglycerol

  • This nucleophilic attack is facilitated by basic residues that may deprotonate the thiol group, enhancing its nucleophilicity

  • A thioether bond forms between the diacylglyceryl moiety and the cysteine sulfur atom

Step 3: Product release

  • The phosphatidic acid byproduct is released laterally back into the membrane

  • The lipidated prolipoprotein exits the enzyme, also laterally relative to the lipid bilayer

  • The enzyme returns to its initial state, ready for another catalytic cycle

This mechanism is consistent with the dual binding sites observed in the crystal structure of E. coli Lgt and explains the essential roles of conserved arginine residues demonstrated through mutagenesis studies . The lateral entry and exit of substrates and products reflects the membrane-embedded nature of both the enzyme and its substrates/products.

What is the relationship between E. fergusonii Lgt and antimicrobial resistance mechanisms?

The relationship between E. fergusonii Lgt and antimicrobial resistance mechanisms is multifaceted, involving both direct and indirect contributions to bacterial survival under antibiotic pressure:

1. Lipoprotein-mediated resistance mechanisms:
E. fergusonii Lgt is essential for the proper lipidation and membrane anchoring of numerous lipoproteins that directly contribute to antimicrobial resistance . These include:

  • Lipoproteins that function as components of efflux pump systems, which expel antibiotics from the cell

  • Lipoproteins involved in maintaining cell envelope integrity, reducing permeability to antimicrobial agents

  • Lipoproteins that directly modify or sequester antibiotics

2. MCR-1 co-occurrence:
Notably, 18.8% of E. fergusonii isolates in a comprehensive study from China carried the colistin resistance gene mcr-1, suggesting that E. fergusonii may serve as an important reservoir for this critical resistance determinant . This high prevalence indicates a potential role for E. fergusonii in the evolution and dissemination of colistin resistance, which is particularly concerning as colistin is often considered a last-resort antibiotic.

3. Multidrug resistance profile:
E. fergusonii isolates commonly exhibit resistance to multiple antibiotics, with high resistance rates observed for:

  • Sulfafurazole (97.74%)

  • Tetracycline (94.74%)

  • Ampicillin (84.21%)

  • Sulfamethoxazole (83.46%)

The proper functioning of Lgt is critical for the expression and activity of many lipoproteins that contribute to this multidrug resistance phenotype. Additionally, transferable resistance traits, such as extended-spectrum beta-lactamases (ESBLs), are frequently detected in E. fergusonii isolates, with 51.88% of isolates in one study being ESBL-positive .

4. Horizontal gene transfer:
The mcr-1-harboring plasmids in E. fergusonii can transfer to recipient strains at relatively high frequencies (10^-4 to 10^-2), highlighting the role of this organism in the interspecies transmission of critical resistance determinants .

These findings collectively establish E. fergusonii as an underappreciated reservoir for antimicrobial resistance genes, with Lgt playing an essential role in the functional expression of many resistance-associated lipoproteins.

How does inhibition of E. fergusonii Lgt affect bacterial survival and virulence?

Inhibition of E. fergusonii Lgt profoundly affects bacterial survival and virulence through multiple mechanisms, making it a potential target for novel antimicrobial strategies:

Impact on bacterial survival:
While the lgt gene is lethal when deleted in most Gram-negative bacteria , its inhibition in E. fergusonii would likely cause:

  • Compromised membrane integrity due to improper lipoprotein processing and localization

  • Disrupted cell division processes that rely on properly lipidated proteins

  • Impaired nutrient acquisition systems that depend on functional lipoproteins

  • Decreased stress tolerance and survival in hostile environments

Effects on virulence mechanisms:
Inhibition of Lgt would significantly attenuate virulence through:

  • Reduced adhesion to host tissues, as many adhesins are lipoproteins requiring Lgt-mediated modification

  • Impaired invasion capabilities due to dysfunction of lipoproteins involved in host-pathogen interactions

  • Compromised immune evasion strategies that rely on properly processed surface lipoproteins

  • Decreased secretion of virulence factors whose transport systems include lipoprotein components

Experimental evidence from related systems:
Studies in other bacterial species demonstrate that Lgt inhibition or deletion:

  • Causes accumulation of unprocessed preprolipoproteins in the cytoplasmic membrane

  • Results in mislocalization of proteins that would normally be anchored to the membrane

  • May allow some lipoproteins to be processed by alternative mechanisms but with reduced efficiency

  • Can lead to altered immunogenicity and reduced inflammatory responses to bacterial infection

Potential as a therapeutic target:
The essential nature of Lgt in most Gram-negative bacteria, combined with its absence in mammalian cells, makes it an attractive target for novel antimicrobial development. Inhibitors targeting Lgt would potentially:

  • Have broad-spectrum activity against multiple Gram-negative pathogens

  • Present a high barrier to resistance development due to the essential nature of the enzyme

  • Show synergistic effects when combined with existing antibiotics by compromising membrane integrity and resistance mechanisms

These multifaceted effects on bacterial survival and virulence underscore the potential of Lgt inhibition as a strategy for combating E. fergusonii infections, particularly in the context of increasing antimicrobial resistance.

What novel approaches are being explored to target Lgt function in multidrug-resistant E. fergusonii?

Recent research efforts have been exploring innovative approaches to target Lgt function in multidrug-resistant bacteria, including E. fergusonii. These emerging strategies represent promising avenues for combating antimicrobial resistance:

1. Structure-based inhibitor design:
Leveraging the high-resolution crystal structures of E. coli Lgt , researchers are using computational methods to design small molecule inhibitors that:

  • Competitively bind to the phosphatidylglycerol binding site

  • Occupy the preprolipoprotein binding pocket

  • Target the interface between the two binding sites to prevent catalytic activity

  • Stabilize inactive conformations of the enzyme

2. Natural product screening:
Several natural products with structural similarities to the lipid substrates or reaction intermediates of Lgt are being evaluated:

  • Plant-derived cyclic lipopeptides that may interfere with Lgt substrate recognition

  • Fungal metabolites that show structural mimicry of diacylglyceryl moieties

  • Marine organism-derived compounds with selective activity against bacterial membrane proteins

3. Peptidomimetic approaches:
Based on the conserved lipobox motif recognized by Lgt, researchers are developing:

  • Synthetic peptides that mimic the lipobox but cannot be processed, thereby competitively inhibiting the enzyme

  • Modified peptides with enhanced binding affinity and reduced susceptibility to proteolytic degradation

  • Cyclic peptides that lock the enzyme in non-productive complexes

4. Antisense technology:
Novel nucleic acid-based approaches include:

  • Antisense oligonucleotides designed to bind lgt mRNA and prevent translation

  • CRISPR-Cas systems engineered to target and cleave the lgt gene or its transcripts

  • Peptide nucleic acids (PNAs) that can penetrate bacterial membranes and inhibit lgt expression

5. Combination approaches:
Synergistic strategies combining Lgt inhibition with other modes of action:

  • Dual inhibitors targeting both Lgt and Lsp (lipoprotein signal peptidase) to completely block lipoprotein processing

  • Lgt inhibitors combined with membrane-permeabilizing agents to enhance access to the target

  • Co-administration with conventional antibiotics to overcome existing resistance mechanisms

These innovative approaches hold promise for developing new therapeutic options against multidrug-resistant E. fergusonii and other Gram-negative pathogens. By targeting the essential Lgt enzyme, these strategies aim to circumvent existing resistance mechanisms and provide novel weapons in the fight against antimicrobial resistance.

How can recombinant E. fergusonii Lgt be utilized in structural vaccinology approaches?

Recombinant E. fergusonii Lgt offers significant potential in structural vaccinology, a field that utilizes detailed structural information to design more effective vaccines. Several strategic approaches can leverage this enzyme for vaccine development:

1. Lgt as a direct vaccine antigen:
Recombinant E. fergusonii Lgt itself can serve as a vaccine antigen due to several advantageous characteristics:

  • High conservation across Escherichia species, potentially providing cross-protection

  • Essential role in bacterial viability, limiting the possibility of escape mutants

  • Unique epitopes not present in mammalian cells, reducing the risk of autoimmunity

  • Membrane localization, making it accessible to immune recognition

2. Lgt-mediated lipoprotein display platforms:
Recombinant E. fergusonii Lgt can be utilized to create engineered bacterial strains that display:

  • Multiple protective antigens as lipoproteins on the bacterial surface

  • Immunomodulatory molecules that enhance adaptive immune responses

  • Targeting ligands that direct vaccine delivery to specific immune cell populations

3. Structure-guided epitope selection:
The structural data from E. coli Lgt can guide the selection of E. fergusonii Lgt epitopes based on:

  • Surface exposure and accessibility to antibodies

  • Conservation across pathogenic strains

  • Involvement in catalytic function, decreasing the likelihood of escape mutations

  • Potential to elicit neutralizing antibodies that inhibit enzyme function

4. Virus-like particle (VLP) presentation:
Recombinant Lgt-derived peptides can be displayed on VLPs to enhance immunogenicity:

  • Multiple copies of Lgt epitopes can be displayed on a single VLP

  • The particulate nature of VLPs promotes uptake by antigen-presenting cells

  • Conformational epitopes can be preserved by appropriate design of fusion proteins

5. Reverse vaccinology approaches:
Computational analyses of E. fergusonii Lgt can identify:

  • B-cell epitopes with high predicted antigenicity

  • T-cell epitopes compatible with common MHC haplotypes

  • Epitopes conserved across multiple pathogenic species

  • Regions likely to be accessible to the immune system

These approaches leverage both the structural knowledge of Lgt and its functional importance to develop vaccines targeting E. fergusonii and potentially other Gram-negative pathogens. By focusing on this essential enzyme, such vaccines could provide protection against multidrug-resistant strains for which current antibiotic treatments are increasingly ineffective.

What methodological challenges exist in studying the interaction between Lgt and its lipoprotein substrates?

Investigating the interactions between E. fergusonii Lgt and its lipoprotein substrates presents numerous methodological challenges due to the membrane-associated nature of both the enzyme and its substrates. Researchers face the following significant obstacles:

1. Membrane protein purification complexities:

  • Maintaining the native conformation of Lgt during extraction from the membrane requires careful detergent selection and optimization

  • The hydrophobic nature of Lgt often leads to aggregation during purification

  • Different detergents may affect enzyme activity and substrate binding differently, complicating interpretation of results

  • Scaling up purification for structural studies remains technically demanding

2. Reconstitution of enzymatic activity in vitro:

  • Creating a suitable lipid environment that mimics the native membrane is challenging

  • The orientation of reconstituted Lgt in artificial membranes or detergent micelles may not reflect the native topology

  • Activity assays may be affected by detergent interference with substrate binding or product release

  • The lateral entry mechanism of substrates is difficult to reproduce in standard in vitro systems

3. Capturing transient enzyme-substrate complexes:

  • The interaction between Lgt and preprolipoprotein substrates is likely transient

  • The dynamic nature of the membrane environment complicates trapping of reaction intermediates

  • Structural studies require stable complexes, whereas the biological system involves rapid substrate turnover

  • Developing suitable substrate analogs that bind but aren't processed remains challenging

4. Real-time monitoring of lipid transfer:

  • The lack of intrinsic spectroscopic signals during catalysis necessitates complex labeling strategies

  • Direct observation of diacylglyceryl transfer in real-time requires sophisticated biophysical techniques

  • Discerning the rate-limiting steps in the catalytic cycle requires capturing multiple reaction intermediates

  • Distinguishing enzyme-specific effects from non-specific membrane perturbations is technically demanding

5. Context-dependent activity assessment:

These methodological challenges require innovative approaches combining traditional biochemistry with advanced biophysical techniques, including nanodiscs for membrane protein reconstitution, single-molecule methods for observing transient interactions, and computational modeling to predict substrate binding modes and catalytic mechanisms.

How can synthetic biology approaches be used to engineer E. fergusonii Lgt for biotechnological applications?

Synthetic biology offers powerful approaches to engineer E. fergusonii Lgt for diverse biotechnological applications, harnessing its unique catalytic properties for purposes beyond its natural function:

1. Designer lipoproteins for drug delivery systems:
Engineered Lgt variants can be developed to:

  • Modify synthetic peptides with custom lipid anchors for targeted drug delivery

  • Create lipidated peptides with enhanced stability and membrane permeability

  • Generate self-assembling lipoprotein nanoparticles for pharmaceutical applications

  • Produce lipopeptide antibiotics with novel structures and activities

2. Substrate specificity engineering:
Directed evolution and rational design can create Lgt variants with:

  • Broadened substrate scope to accept non-natural lipid donors

  • Modified lipobox recognition to process designer signal sequences

  • Altered regioselectivity for attachment of lipids to non-canonical amino acids

  • Enhanced catalytic efficiency for biotechnological applications

3. Biorthogonal lipid modification:
Engineered Lgt systems can enable:

  • Site-specific protein modification with functional lipids containing reactive handles

  • Creation of membrane-anchored protein libraries for display technologies

  • Development of click chemistry-compatible lipid anchors for protein conjugation

  • Assembly of artificial membrane systems with precisely positioned components

4. Cell surface display technologies:
Modified Lgt can facilitate:

  • Enhanced display of recombinant proteins on bacterial surfaces for biocatalysis

  • Development of whole-cell biosensors with lipid-anchored recognition elements

  • Creation of bacterial adhesins with tailored binding properties

  • Vaccine antigen presentation platforms with optimized immunogenicity

5. Industrial enzyme immobilization:
Engineered Lgt systems offer advantages for:

  • Stable anchoring of industrial enzymes to synthetic membranes or particles

  • Creation of multi-enzyme complexes with enhanced catalytic efficiency

  • Development of reusable biocatalysts with improved stability

  • Generation of enzyme-decorated surfaces for bioremediation applications

Implementation of these synthetic biology approaches requires systematic characterization of structure-function relationships in Lgt, development of high-throughput screening methods for engineered variants, and integration of computational design with experimental validation. The successful engineering of E. fergusonii Lgt could enable novel biotechnologies at the interface of protein science, membrane biology, and synthetic chemistry.

How has Lgt function evolved across different Escherichia species?

The evolution of Lgt function across different Escherichia species reflects both conservation of essential catalytic mechanisms and species-specific adaptations. Comparative genomic and functional analyses reveal several important evolutionary patterns:

Differential evolutionary rates:
E. fergusonii Lgt appears to have evolved more rapidly compared to E. coli Lgt, consistent with the observation that E. fergusonii as a species has experienced more rapid evolution than E. coli . This accelerated evolution may reflect adaptation to different ecological niches or host associations, potentially conferring advantages in specific environments.

Substrate specificity variations:
While the basic catalytic mechanism remains conserved, subtle variations in the substrate binding pockets may influence:

  • Recognition efficiency for different lipobox sequences

  • Preference for specific phospholipid donors

  • Processing kinetics under different physiological conditions

  • Interactions with other components of the lipoprotein processing machinery

Regulatory differences:
The expression and regulation of lgt genes differ across Escherichia species, with variations in:

  • Promoter architecture and transcription factor binding sites

  • Responses to environmental stressors and nutrient availability

  • Integration with species-specific regulatory networks

  • Coordination with other membrane protein synthesis pathways

Functional essentiality:
While lgt is essential in most Gram-negative bacteria , the degree of essentiality may vary across species and environments. For example, in C. glutamicum (though not an Escherichia species), lgt is not essential , suggesting potential diversity in the absolute requirement for Lgt function across bacterial lineages.

These evolutionary patterns reflect the balance between conservation of essential enzymatic function and adaptation to species-specific requirements, highlighting the dynamic nature of bacterial membrane protein evolution even within closely related species. Understanding these evolutionary relationships provides insights into both the fundamental biology of bacterial lipoproteins and potential species-specific vulnerabilities that could be exploited for targeted antimicrobial development.

What techniques can differentiate between E. fergusonii Lgt and closely related species' Lgt proteins?

Differentiating between E. fergusonii Lgt and closely related species' Lgt proteins requires a combination of molecular, biochemical, and computational approaches to detect subtle but significant differences. The following techniques provide complementary methods for reliable differentiation:

1. Genomic and sequence-based methods:

Multiplex PCR assays:

  • Design primers targeting the lgt gene with species-specific variations

  • Utilize the approach similar to the multiplex PCR developed for species identification

  • Include internal controls targeting conserved regions for validation

  • Perform high-resolution melt curve analysis to detect single nucleotide polymorphisms

Whole genome sequencing and comparative genomics:

  • Analyze full lgt gene sequences and flanking regions

  • Examine synteny and genomic context of the lgt gene

  • Identify species-specific single nucleotide polymorphisms or indels

  • Apply phylogenetic analysis to place unknown sequences in evolutionary context

2. Protein-based differentiation methods:

Mass spectrometry approaches:

  • Perform peptide mass fingerprinting after enzymatic digestion

  • Use multiple reaction monitoring (MRM) to detect species-specific peptides

  • Apply top-down proteomics to analyze intact protein masses

  • Identify post-translational modifications unique to each species

Immunological methods:

  • Develop antibodies targeting species-specific epitopes

  • Perform Western blots with differential detection patterns

  • Use epitope mapping to identify unique surface-exposed regions

  • Employ sandwich ELISA with species-specific detection antibodies

3. Functional differentiation approaches:

Enzyme kinetic analysis:

  • Compare catalytic efficiency (kcat/KM) using standardized substrates

  • Analyze pH and temperature optima profiles

  • Measure substrate specificity ranges

  • Determine inhibitor sensitivity patterns

Thermal stability profiling:

  • Perform differential scanning fluorimetry to determine melting temperatures

  • Analyze unfolding pathways through calorimetric methods

  • Measure activity retention after thermal challenge

  • Assess detergent stability profiles

4. Computational prediction methods:

Machine learning classification:

  • Train algorithms on sequence features to differentiate between species

  • Use structural predictions to identify species-specific conformational differences

  • Apply neural networks for automated species assignment

  • Incorporate evolutionary information through profile hidden Markov models

These complementary approaches provide multiple lines of evidence for differentiating E. fergusonii Lgt from closely related homologs, essential for accurate identification in research, diagnostic, and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.