Recombinant Escherichia fergusonii Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
crcB; EFER_2479; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWMLSMRFNPLHQAIPLGTLAANLLGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWAMLNVLVNLLGSFAMTALAFWI FSASTAN
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Escherichia fergusonii and how does it differ from Escherichia coli?

Escherichia fergusonii is a close relative of E. coli within the Enterobacteriaceae family. While often misidentified as E. coli in routine laboratory testing, E. fergusonii possesses distinct biochemical properties:

  • E. fergusonii strains are typically motile, non-lactose and non-sorbitol fermenting

  • They show positive results for cellobiose and adonitol fermentation

  • They can be definitively identified using 16S rRNA sequencing analysis

  • When using API 20E identification kits, E. fergusonii is frequently misidentified as E. coli, necessitating molecular confirmation

Molecular identification using PCR primers targeting specific genes (such as the conserved hypothetical cellulose synthase protein and putative transcriptional activator genes) provides more accurate identification compared to biochemical methods. Duplex PCR using EFER 13- and EFER YP-specific primers has demonstrated high specificity for E. fergusonii identification .

What is the CrcB homolog protein in E. fergusonii and what are its structural characteristics?

The CrcB homolog protein in E. fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) is encoded by the crcB gene (EFER_2479) and functions as a putative fluoride ion channel. Key characteristics include:

  • Full amino acid sequence: mLQLLLAVFIGGGTGSVARWmLSMRFNPLHQAIPLGTLAANLLGAFIIGMGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWAmLNVLVNLLGSFAMTALAFWIFSASTAN

  • Expression region: 1-127 amino acids

  • Contains multiple transmembrane domains that form channel structures

  • Has evolutionary conservation across multiple bacterial species

The protein is typically stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage, with recommendations against repeated freeze-thaw cycles to maintain structural integrity .

How can I properly store and handle recombinant E. fergusonii CrcB homolog protein for experimental use?

For optimal maintenance of protein activity and structural integrity:

  • Store the recombinant protein at -20°C for regular use

  • For extended storage, maintain at -80°C

  • Create working aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Use a storage buffer consisting of Tris-based buffer with 50% glycerol, optimized for this specific protein

  • When thawing frozen stocks, do so gradually on ice to prevent protein denaturation

What methods are recommended for accurate molecular identification of E. fergusonii isolates?

Accurate identification of E. fergusonii requires a combination of phenotypic and molecular approaches:

Phenotypic methods:

  • Morphological and physiological tests (limited accuracy)

  • MALDI-TOF/MS analysis

  • API 20E identification kits (with limitations)

Molecular methods (higher specificity):

  • 16S rRNA gene sequencing (recommended as gold standard)

  • PCR targeting specific E. fergusonii genes:

    • Duplex PCR using EFER 13 and EFER YP primers

    • PCR targeting the yliE conserved hypothetical protein gene

    • PCR targeting regulator of cellulose synthase and hypothetical protein genes

Researchers should note that API 20E kits frequently misidentify E. fergusonii as E. coli, making molecular confirmation essential. Sequence analysis should show approximately 98% alignment with E. fergusonii ATCC 35469 reference strain for confident identification .

What approaches are effective for genetic manipulation of E. fergusonii and the crcB gene specifically?

For genetic manipulation of E. fergusonii, particularly targeting the crcB gene, researchers can apply several techniques adapted from E. coli methodologies:

  • Homologous recombination-based modification:

    • This approach can be used directly in recombination-deficient E. coli host strains

    • For modifying the crcB gene, design homologous sequences flanking the target region

    • Introduce marker genes (such as IRES-LacZ) for selection

    • Verify modifications through sequencing to ensure no rearrangements or deletions occurred

  • Conjugation-based methods:

    • Use broth-mating methods with E. fergusonii as donors and rifampicin-resistant E. coli strains as recipients

    • Select transconjugants on media containing appropriate antibiotics

    • Confirm successful transfer using PCR targeting the gene of interest

    • Characterize resulting strains using molecular typing methods

  • CRISPR-Cas9 system adaptation:

    • Design guide RNAs targeting specific regions of the crcB gene

    • Utilize repair templates containing desired modifications

    • Screen transformants for successful modifications

    • Confirm modifications through sequencing and functional assays

When manipulating the crcB gene specifically, researchers should consider its role in fluoride resistance and potential impacts on bacterial physiology when designing experiments.

What is the relationship between E. fergusonii and antimicrobial resistance, particularly regarding beta-lactamase genes?

E. fergusonii has emerged as an important reservoir for antimicrobial resistance genes, with particular concern regarding beta-lactamase genes:

Beta-lactamase gene prevalence in E. fergusonii:

  • CTX-M (cefotaximase) genes: Detected in both human and animal isolates

  • TEM (temoniera) beta-lactamase genes: Found in multiple clinical isolates

  • SHV (sulfhydryl variable) beta-lactamase genes: Identified in both human and animal isolates

ESBL production:

  • Studies have found high prevalence (51.88%) of extended-spectrum beta-lactamase (ESBL) production among E. fergusonii isolates

  • ESBL-producing E. fergusonii can be resistant to multiple beta-lactam antibiotics including cephalosporins

  • Double-disc synergy test is effective for screening ESBL production

Carbapenem resistance:

  • Carbapenem-resistant E. fergusonii have been detected in clinical samples

  • These strains often harbor multiple beta-lactamase genes

  • Resistance to imipenem and meropenem has been observed in isolates from both human and animal sources

This high prevalence of resistance genes makes E. fergusonii an important consideration in clinical microbiology and antimicrobial stewardship efforts.

How does the CrcB homolog protein potentially contribute to antimicrobial resistance mechanisms?

While the CrcB homolog protein's primary function relates to fluoride ion transport, several potential connections to antimicrobial resistance have been proposed:

Research examining direct connections between CrcB homologs and specific resistance mechanisms represents an important frontier for future investigation.

What experimental methods are recommended for characterizing plasmid-mediated resistance transfer in E. fergusonii?

For investigating plasmid-mediated resistance transfer in E. fergusonii, researchers should employ a systematic approach:

Conjugation experiments:

  • Use broth-mating method with E. fergusonii as donors and rifampicin-resistant E. coli (e.g., ATCC25922 or E. coli J53) as recipients

  • Select transconjugants on media containing appropriate antibiotics (e.g., rifampicin 50 μg/mL and colistin 2 μg/mL)

  • Confirm transconjugants by:

    • Antimicrobial susceptibility testing differences

    • PCR detection of resistance genes

    • MALDI-TOF/MS identification

Plasmid characterization:

  • S1-PFGE to visualize and size plasmids

  • Southern blotting with gene-specific probes to locate resistance genes

  • PCR-based replicon typing (PBRT) to identify plasmid incompatibility groups

  • Whole-genome sequencing for complete plasmid characterization

Conjugation frequency determination:

  • Calculate ratio of transconjugants to recipients

  • Document frequencies (typically range from 10^-4 to 10^-2 for mcr-harboring plasmids)

  • Compare frequencies across different plasmid types

Data presentation example:

Transferred replicons (Inc)Strains from pigs (n=11)Strains from chickens (n=43)
No. of strainsPositive rate (%)No. of strainsPositive rate (%)
I2981.83376.7
HI1, F, I20049.3
HI1, I219.124.7
I1, I219.100
F, I20037
I2, FIB0012.3
Total1143

Table adapted from research on plasmid replicon types detected in mcr-1-harboring-transconjugants of E. fergusonii from different animal sources

How can the CrcB homolog protein be used as a model for studying transmembrane channel function in research?

The CrcB homolog protein offers several advantages as a model system for studying transmembrane channel function:

Experimental approaches:

  • Protein purification and reconstitution:

    • Express recombinant CrcB protein using optimized expression systems

    • Purify using affinity chromatography with appropriate tags

    • Reconstitute in proteoliposomes or nanodiscs for functional studies

    • Measure ion flux using fluorescent indicators or electrophysiological methods

  • Structure-function analysis:

    • Generate site-directed mutants targeting key residues in transmembrane domains

    • Perform conductance measurements to correlate structural features with channel function

    • Use computational modeling to predict conformational changes during gating

    • Compare with characterized channels to identify conserved functional motifs

  • Physiological relevance studies:

    • Create CrcB knockout strains and characterize phenotypes

    • Conduct complementation studies with mutant variants

    • Examine expression changes under different stress conditions

    • Investigate interactions with other membrane proteins through co-immunoprecipitation or FRET analysis

  • Comparative analysis:

    • Examine functional conservation across CrcB homologs from different bacterial species

    • Correlate evolutionary divergence with functional specialization

    • Use insights to inform research on related human channel proteins

This system offers valuable insights into basic membrane biology while providing practical applications for biotechnology and drug development research.

What are the most effective experimental designs for studying the relationship between CrcB expression and antimicrobial resistance profiles?

To comprehensively investigate the relationship between CrcB expression and antimicrobial resistance, researchers should consider these experimental approaches:

Gene expression manipulation studies:

  • Overexpression analysis:

    • Clone the crcB gene into inducible expression vectors

    • Transform into both E. fergusonii and heterologous hosts

    • Induce expression at various levels

    • Determine MICs for multiple antibiotic classes before and after induction

    • Measure membrane permeability changes using fluorescent dyes

  • Gene knockout or knockdown:

    • Create crcB deletion mutants using homologous recombination

    • Alternatively, use CRISPR interference for conditional knockdown

    • Evaluate changes in antimicrobial susceptibility patterns

    • Perform complementation studies to confirm phenotype specificity

    • Measure stress response activation to various antimicrobials

Transcriptional regulation analysis:

  • Promoter activity studies:

    • Create reporter constructs (e.g., luciferase, GFP) fused to crcB promoter

    • Measure promoter activity under exposure to different antimicrobials

    • Identify regulatory elements and transcription factors involved

    • Perform ChIP-seq to map regulator binding sites

  • RNA-seq comparative transcriptomics:

    • Compare wild-type and crcB mutant strains under antimicrobial stress

    • Identify co-regulated genes and pathways

    • Construct regulatory networks to position CrcB in stress response pathways

    • Validate key findings with RT-qPCR

Protein-protein interaction studies:

  • Pull-down assays and co-immunoprecipitation:

    • Use tagged CrcB protein to identify interacting partners

    • Focus on components of resistance mechanisms (efflux pumps, etc.)

    • Validate interactions using alternative methods (Y2H, FRET)

    • Map interaction domains through truncation mutants

These approaches should be combined with standard antimicrobial susceptibility testing to generate a comprehensive understanding of CrcB's role in resistance.

How can whole-genome sequencing and bioinformatics be optimally applied to characterize E. fergusonii isolates harboring the crcB gene?

A comprehensive whole-genome sequencing and bioinformatics workflow for characterizing E. fergusonii isolates should include:

Sequencing strategy:

  • Hybrid sequencing approach:

    • Short-read sequencing (Illumina) for high accuracy

    • Long-read sequencing (Oxford Nanopore/PacBio) for resolving repetitive regions and plasmids

    • Target coverage: 100x for short reads, 30-50x for long reads

    • Include RNA-seq for transcriptome analysis when appropriate

  • Assembly and annotation:

    • Perform hybrid assembly using tools like Unicycler or Flye

    • Annotate genomes using Prokka and specialized databases

    • Specifically examine the crcB gene and surrounding genetic context

    • Look for genomic islands, prophages, and insertion sequences using tools like IslandViewer and PHASTER

Comparative genomics:

  • Core genome analysis:

    • Build core genome phylogeny using tools like Roary and RAxML

    • Identify lineage-specific gene acquisitions and losses

    • Map antimicrobial resistance genes to phylogenetic structure

    • Analyze crcB gene evolution in context of species evolution

  • Plasmid analysis:

    • Characterize plasmid replicon types (especially IncI2, IncX4, IncHI2)

    • Analyze plasmid incompatibility groups and transfer mechanisms

    • Examine co-localized resistance genes and mobility elements

    • Track horizontal gene transfer events through comparative analysis

Resistance gene characterization:

  • Comprehensive resistance gene detection:

    • Use multiple databases (ResFinder, CARD, AMRFinder)

    • Identify chromosomal point mutations in resistance-conferring genes

    • Map resistance phenotypes to genetic elements

    • Analyze mobile genetic elements associated with resistance genes

  • Target gene analysis:

    • Perform detailed analysis of crcB gene sequence and context

    • Identify mutations affecting protein structure or expression

    • Compare with reference strains to detect evolutionary patterns

    • Correlate genetic variations with phenotypic characteristics

This comprehensive approach allows researchers to place crcB gene findings within the broader context of genome evolution and antimicrobial resistance mechanisms.

What are the most promising research gaps regarding E. fergusonii CrcB homolog that warrant further investigation?

Several high-priority research areas remain underexplored regarding the E. fergusonii CrcB homolog:

  • Structural biology:

    • High-resolution structural determination via X-ray crystallography or cryo-EM

    • Conformational changes during ion transport

    • Structural basis of selectivity and gating

    • Comparative structural analysis with other members of the CrcB family

  • Regulatory networks:

    • Complete characterization of transcriptional and post-transcriptional regulation

    • Environmental signals affecting expression

    • Role in global stress responses

    • Integration with bacterial physiology under different growth conditions

  • Functional versatility:

    • Potential secondary functions beyond fluoride transport

    • Role in other ion homeostasis mechanisms

    • Interactions with membrane lipids and modulation of membrane properties

    • Impact on bacterial biofilm formation and persistence

  • Host-pathogen interactions:

    • Role during colonization or infection processes

    • Impact on immune response evasion

    • Contribution to bacterial survival in host environments

    • Potential as a target for novel antimicrobials or inhibitors

  • Evolutionary significance:

    • Selective pressures driving crcB evolution

    • Horizontal gene transfer patterns across bacterial species

    • Ancestral functions and evolutionary trajectory

    • Comparative genomics across diverse bacterial lineages

Addressing these research gaps would significantly advance our understanding of this important protein family and its biological significance.

What methodological challenges exist in studying recombinant E. fergusonii CrcB homolog protein, and how can they be addressed?

Researchers face several methodological challenges when working with recombinant E. fergusonii CrcB homolog protein:

Challenge 1: Protein expression and purification

  • Issues: Membrane proteins like CrcB often express poorly and can be toxic to host cells

  • Solutions:

    • Use specialized expression strains (C41/C43, Lemo21)

    • Optimize codon usage for expression host

    • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Employ cell-free expression systems for toxic proteins

    • Use nanodiscs or amphipols to maintain native structure during purification

Challenge 2: Functional characterization

  • Issues: Standard assays may not accurately reflect in vivo function

  • Solutions:

    • Develop fluoride-specific fluorescent probes for transport assays

    • Establish proteoliposome-based flux assays

    • Adapt electrophysiological techniques for single-channel recordings

    • Combine in vitro and in vivo approaches for validation

    • Use computational modeling to guide experimental design

Challenge 3: Structural analysis

  • Issues: Membrane proteins present specific difficulties for structural determination

  • Solutions:

    • Screen multiple detergents and lipid environments

    • Consider lipidic cubic phase crystallization approaches

    • Explore cryo-EM for structure determination without crystallization

    • Use hydrogen-deuterium exchange mass spectrometry for conformational studies

    • Apply molecular dynamics simulations to understand dynamics

Challenge 4: Specificity of antibodies and detection methods

  • Issues: Cross-reactivity with other membrane proteins

  • Solutions:

    • Design peptides from unique regions for antibody generation

    • Validate antibody specificity using knockout controls

    • Use epitope tagging strategies (FLAG, His) when possible

    • Develop targeted mass spectrometry methods for detection

    • Consider proximity labeling approaches for interaction studies

Challenge 5: Physiological relevance assessment

  • Issues: Connecting in vitro findings to biological significance

  • Solutions:

    • Create conditional expression systems in native host

    • Develop fluorescent reporters for real-time expression monitoring

    • Establish animal models for studying contribution to pathogenesis

    • Use tissue culture models to study host-pathogen interactions

    • Apply systems biology approaches to integrate multi-omics data

Addressing these methodological challenges requires interdisciplinary approaches and careful experimental design.

What biosafety considerations should be addressed when working with E. fergusonii strains harboring antimicrobial resistance genes?

When conducting research with antimicrobial-resistant E. fergusonii, researchers must implement comprehensive biosafety measures:

Containment and handling:

  • Use Biosafety Level 2 (BSL-2) practices and facilities as minimum requirement

  • Consider enhanced BSL-2+ practices for strains with extensive drug resistance

  • Implement strict laboratory access controls and training requirements

  • Use biological safety cabinets for all procedures creating aerosols

  • Develop specific standard operating procedures (SOPs) for handling resistant strains

Waste management:

  • Decontaminate all waste before disposal using validated methods

  • Use chemical disinfection with demonstrated efficacy against resistant strains

  • Autoclave all solid waste materials at 121°C for minimum 30 minutes

  • Maintain detailed waste treatment and disposal records

  • Validate disinfection efficacy periodically against actual research strains

Institutional review:

  • Obtain appropriate Institutional Biosafety Committee (IBC) approvals

  • Conduct comprehensive risk assessments before initiating work

  • Develop strain-specific contingency plans for accidental exposures

  • Establish clear reporting mechanisms for incidents

  • Implement regular safety audits and procedural reviews

Strain management:

  • Maintain detailed inventory of all resistant strains

  • Implement dual verification for strain transfers

  • Use secure storage systems with restricted access

  • Consider using attenuated strains when appropriate for research questions

  • Develop strain destruction protocols for project completion

Personnel considerations:

  • Provide specialized training for researchers working with resistant organisms

  • Implement medical surveillance programs when appropriate

  • Restrict laboratory personnel from areas where antimicrobials are administered

  • Develop post-exposure protocols specific to resistant strains

  • Consider excluding immunocompromised individuals from direct work

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.