Recombinant Escherichia fergusonii Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Membrane Protein Quality Control

GlpG cleaves orphan subunits of respiratory complexes (e.g., hydrogenase-2 and formate dehydrogenases) to prevent membrane aggregation and license their degradation . Mutating conserved prolines (e.g., HybAᴾ³⁰⁰ᴬ) renders substrates resistant to proteolysis .

Gut Colonization and Virulence

In pathogenic E. coli, GlpG promotes persistence within the gut by regulating fatty acid β-oxidation and glycerol degradation pathways . Disruption of glpG reduces bacterial fitness >120-fold in murine colonization models .

Biofilm Regulation

GlpG indirectly modulates biofilm formation by processing virulence factors like type 1 pili, which are critical for host cell adhesion . Inhibiting GlpG activity reduces biofilm production, highlighting its therapeutic potential .

Enzymatic Activity Assays

Recombinant GlpG cleaves model substrates (e.g., Bla-LY2-MBP) between hydrophilic residues (e.g., Ser-Asp) in vitro . Key kinetic parameters:

SubstrateCleavage SiteCatalytic Efficiency
Bla-LY2-MBPSer-Asp (TMD boundary)k<sub>cat</sub> ≈ 0.006/s
Gurken TMD (GknTM)Hydrophilic juxtamembrane regionMembrane-impermeable

Research Applications

  • Mechanistic Studies: Used to explore intramembrane proteolysis and substrate specificity .

  • Therapeutic Development: Targeted to disrupt biofilm formation in pathogenic E. coli .

  • Evolutionary Analysis: Comparative studies with Shigella Rhom7 and E. coli GlpG to understand rhomboid diversification .

Key Research Findings

  1. Substrate Specificity: GlpG selectively targets orphaned TMDs with destabilizing residues, sparing functional complexes .

  2. Regulatory Role: Cleavage by GlpG licenses downstream degradation of substrates by other proteases (e.g., FtsH) .

  3. Pathogenicity Link: glpG mutants exhibit severe colonization defects, underscoring its role in nutrient utilization and stress adaptation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for precise delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us beforehand, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your needs.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize development of the specified tag.
Synonyms
glpG; EFER_3392; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESLAERVRSELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhomboid protease glpG and why is it significant for research?

Rhomboid proteases are intramembrane-integrated enzymes that hydrolyze peptide bonds within the transmembrane domains of protein substrates . Specifically, GlpG from Escherichia fergusonii is one of the model systems for structural investigations of the rhomboid family . Its significance comes from its role as an intramembrane serine protease (EC 3.4.21.105) , providing insights into membrane protein dynamics and catalytic mechanisms occurring within lipid bilayers.

The study of GlpG contributes to our understanding of:

  • Intramembrane proteolysis mechanisms

  • Protein-membrane interactions

  • Evolution of proteolytic enzymes

  • Potential antimicrobial targets (as E. fergusonii is an emerging pathogen)

How does the catalytic mechanism of GlpG differ from canonical serine proteases?

Unlike typical serine proteases, E. fergusonii GlpG demonstrates:

  • Weaker hydrogen bonding network: Experimental evidence shows that the catalytic residues in GlpG engage through weak hydrogen bonding interactions compared to canonical serine proteases

  • Membrane environment effects: The catalytic activity occurs within the membrane bilayer, affecting the reaction mechanism and kinetics

  • Conformational dynamics: TM5 exhibits conformational exchange between open and closed states, suggesting a dynamic regulation of substrate access

This atypical hydrogen bonding pattern represents a unique case among serine proteases, where GlpG achieves catalytic proteolysis without requiring the strong hydrogen bond network typically seen in this enzyme family .

What experimental approaches are most effective for studying GlpG dynamics in membrane environments?

When investigating GlpG dynamics in membrane environments, several methodological approaches have proven effective:

  • Solid-state NMR spectroscopy: This technique has successfully confirmed the presence of water molecules in the catalytic cavity and revealed previously unobserved structural features like the kink in TM5

  • Double mutant thermodynamic cycles: Combined with stability measurements under mild detergent conditions (n-dodecyl-β-D-maltopyranoside micelles), this approach allows dissection of interaction energies between active site residues

  • Relaxation dispersion experiments: These have been effective in detecting conformational exchange processes, such as the open/closed conformations of TM5

  • Reconstitution in native-like lipid environments: This provides more physiologically relevant conditions compared to detergent micelles used in crystallography

TechniqueAdvantagesKey Insights Provided
Solid-state NMRWorks with membrane-embedded proteins; detects dynamicsWater in catalytic cavity; TM5 kink; dynamic hotspots
Double mutant cyclesQuantifies interaction energiesWeak H-bonding network in active site
Relaxation dispersionDetects conformational exchangeOpen/closed states of gating helix
Lipid reconstitutionMimics native environmentEnzymatically active state

What are the competing models for substrate gating in GlpG and how might they be experimentally distinguished?

Two different models of substrate gating have been proposed for GlpG based on crystal structures in detergent micelles . Distinguishing between these models requires careful experimental design:

Competing Models:

  • TM5 Lateral Movement Model: Proposes that TM5 moves laterally to create an opening for substrate entry

  • Loop Displacement Model: Suggests that loop regions (particularly L4) move to allow substrate access

Experimental Approaches to Distinguish These Models:

  • Site-directed spin labeling with EPR: By strategically placing spin labels at key positions in TM5 and L4, researchers can monitor conformational changes upon substrate binding

  • Cross-linking studies: Introducing pairs of cysteine residues at key positions can help determine which regions move during substrate binding

  • Molecular dynamics simulations: Coupled with experimental validation to predict energetically favorable gating mechanisms

  • Optimal experimental design: Following principles of model discrimination, researchers should target experimental conditions where the models make maximally different predictions

What considerations are important when designing GLP-compliant studies for rhomboid proteases?

When conducting Good Laboratory Practice (GLP) studies with rhomboid proteases like GlpG, researchers should consider:

  • Method validation: Methods should be validated before finalization of the GLP study results, with data accurately recorded and stored for study reconstruction

  • Pilot studies: Before conducting expensive GLP studies, perform pilot experiments to identify and address potential issues

  • Reference materials: All reference items must be labeled with complete information including expiry dates. Using materials without known expiry dates constitutes a GLP deviation

  • Test item accountability: Maintain traceability of test items to ensure correct quantities are used in preparations

  • Sample handling: Residual samples should be retained as long as their quality permits evaluation (at least until the end of their validated stability period)

  • Final reporting: Deviations from GLP principles must be explained in the final report with justification of why they don't impact study validity

How do interaction energies between active site residues in E. fergusonii GlpG compare with other serine proteases?

A distinctive feature of E. fergusonii GlpG is the weak hydrogen bonding network in its active site compared to canonical serine proteases:

  • Experimental evidence: Double mutant thermodynamic cycles combined with stability measurements revealed significantly weaker interaction energies between His254, Ser201, and Asn154 compared to typical serine proteases

  • Functional implications: Despite these weak interactions, GlpG maintains catalytic activity, suggesting a specialized adaptation for intramembrane proteolysis

  • Evolutionary perspective: This weak hydrogen bonding pattern may represent an adaptation to the membrane environment, distinguishing rhomboid proteases from classical serine proteases

This finding challenges the traditional view that strong hydrogen bonding networks are essential for catalytic proteolysis in all serine proteases .

What statistical approaches are recommended for analyzing structural and functional data from GlpG studies?

Several statistical approaches are valuable when analyzing data from GlpG experiments:

  • Bayesian experimental design: For efficient optimization of experimental conditions without requiring extensive posterior calculations

  • Model discrimination techniques: When testing competing hypotheses about mechanisms, using experimental designs that maximize the difference between model predictions

  • Causal mechanism identification: When investigating how structural features affect function, experimental designs that identify causal pathways rather than just correlations

  • For structural data:

    • Chemical shift analysis for secondary structure determination

    • Relaxation dispersion curve fitting for conformational exchange rates

    • Distance constraint refinement for structural models

  • For kinetic data:

    • Nonlinear regression for enzyme kinetics

    • Global fitting of multiple datasets when examining structure-function relationships

What are the key challenges in expressing and purifying functional recombinant E. fergusonii GlpG?

Obtaining functional recombinant E. fergusonii GlpG presents several methodological challenges:

  • Membrane protein expression barriers:

    • Toxicity to host cells

    • Proper membrane targeting and insertion

    • Achieving sufficient expression levels

  • Purification considerations:

    • Selection of appropriate detergents that maintain protein stability and activity

    • Removal of lipids while preserving native-like environment

    • Preventing aggregation during concentration

  • Quality control methods:

    • Verification of proper folding in membrane mimetics

    • Assessment of catalytic activity using appropriate substrates

    • Confirmation of structural integrity

  • Storage stability:

    • Optimal buffer conditions (Tris-based buffer with 50% glycerol is recommended)

    • Temperature considerations (store at -20°C, for extended storage at -80°C)

    • Avoiding repeated freeze-thaw cycles

How can researchers design experiments to investigate the substrate specificity of E. fergusonii GlpG?

Investigating substrate specificity requires careful experimental design:

  • Substrate library approaches:

    • Systematic variation of amino acid sequences around potential cleavage sites

    • Assessment of kinetic parameters (kcat/KM) for each substrate variant

    • Positional scanning peptide libraries to map specificity determinants

  • Structural approaches:

    • Co-crystallization with substrate analogs or inhibitors incorporating reactive phosphonate groups

    • Mapping substrate binding sites using site-directed mutagenesis

    • Cross-linking studies to capture substrate-enzyme interactions

  • Computational methods:

    • Molecular docking of potential substrates

    • Molecular dynamics simulations of substrate-enzyme complexes

    • Machine learning prediction of cleavage sites based on experimental data

  • Optimal experimental design strategies:

    • Using adversarial approaches to efficiently find conditions that reveal specificity patterns

    • Parallel and crossover experimental designs to identify causal mechanisms in substrate recognition

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.