Recombinant Escherichia fergusonii Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
arnC; EFER_0915; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-326
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
arnC
Target Protein Sequence
MFEIHPIKKVSVVIPVYNEQESLPELINRTTAACESLGKEYEILLIDDGSSDASAQMLVE ASQAPDSHIVSILLNRNYGQHSAIMAGFSYVTGDLIITLDADLQNPPEEIPRLVAKADEG YDVVGTVRQNRQDSWFRKTASKMINRLIQRTTGKAMGDYGCMLRAYRRHIVDAMLHCHER STFIPILANIFARQAVEIPVHHAEREFGESKYSFMRLINLMYDLVTCLTTTPLRMLSLLG SIIATSGFSLAILLVVLRLAFGSQWSGEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYN DVRARPRYFVQKVIRPASSIDIEENH
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxins and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Escherichia fergusonii and how does it differ from Escherichia coli?

Escherichia fergusonii is a rod-shaped, gram-negative bacterium belonging to the genus Enterobacteriaceae. It is a peritrichous, non-spore-forming, and flagellated bacterium with a diameter between 0.8 and 1.5 mm and lengths between 2 and 5 mm. First isolated from human blood samples in 1985, E. fergusonii shows strong genetic resemblance to E. coli, with DNA hybridization revealing a 64% similarity .

From a research perspective, it's important to note that E. fergusonii has emerged as a significant repository of antimicrobial resistance genes. When studying this organism, researchers should be aware that a total of 133 E. fergusonii isolates from food animals in China demonstrated diverse genetic relationships, with resistance to sulfafurazole (97.74%) and tetracycline (94.74%) being most common . Unlike E. coli, E. fergusonii harbors several unique genomic elements that affect its antimicrobial resistance profile, including a high prevalence of extended spectrum beta-lactamase (ESBL) positive strains (51.88%) .

What is the function of arnC in the antimicrobial resistance pathway?

ArnC is a critical enzyme within the arn operon that plays a specific role in the lipid A modification pathway conferring resistance to polymyxins and other cationic antimicrobial peptides. Specifically, ArnC (also known as PmrF) appends 4-formamido-arabinose (Ara4FN) to bactoprenyl phosphate (BP) to produce bactoprenyl monophosphate-4-formamido-arabinose (BP-Ara4FN) .

This reaction represents a crucial step in the biosynthetic pathway that enables bacteria to modify their lipopolysaccharide (LPS) with 4-aminoarabinose, reducing the negative charge of the bacterial outer membrane and decreasing affinity for cationic antimicrobial peptides. Notably, only the formylated sugar nucleotide (UDP-β-(4-deoxy-4-formamido-L-arabinose)) is converted in vitro to an undecaprenyl phosphate-linked form by ArnC , indicating high substrate specificity.

To study this function effectively, researchers should employ genetic deletion studies alongside biochemical assays measuring transferase activity with purified components.

How does the arn operon function to confer polymyxin resistance?

The arn operon (also known as the pmr operon) encompasses a series of genes that work in concert to modify lipid A with 4-aminoarabinose. The complete pathway functions as follows:

  • In the cytosol, UDP-glucose is converted to UDP-L-4-formamido-arabinose (UDP-Ara4FN) via the sequential actions of Ugd, ArnA, and ArnB .

  • Membrane-bound ArnC (PmrF) appends Ara4FN to bactoprenyl phosphate to produce BP-Ara4FN.

  • ArnD (PmrJ) deformylates BP-Ara4FN to produce BP-Ara4N.

  • ArnE/F (PmrM/L) flippase heterodimer translocates BP-Ara4N to the periplasm.

  • ArnT (PmrK) transfers Ara4N from BP-Ara4N to lipid A.

This modification pathway is regulated by two-component systems responding to environmental signals like low Mg²⁺ or the presence of antimicrobial peptides. The addition of the positively charged Ara4N to lipid A reduces the negative charge of the outer membrane, decreasing the binding affinity of polymyxins and other cationic antimicrobial peptides .

What methods are used to express and purify recombinant arnC from E. fergusonii?

Expression and purification of recombinant ArnC from E. fergusonii typically follows these methodological steps:

  • Gene Cloning:

    • PCR amplification of the arnC gene from E. fergusonii genomic DNA

    • Cloning into an expression vector with an appropriate tag (His-tag is commonly used)

    • Transformation into an E. coli expression strain (BL21(DE3) or similar)

  • Protein Expression:

    • Culture growth to appropriate density (OD₆₀₀ of 0.6-0.8)

    • Induction with IPTG (typically 0.5-1 mM)

    • Expression at reduced temperature (16-25°C) to enhance solubility of membrane-associated protein

  • Membrane Fraction Preparation:

    • Cell lysis by sonication or French press

    • Differential centrifugation to isolate membrane fractions

    • Solubilization using appropriate detergents (n-dodecyl-β-D-maltoside or similar)

  • Purification:

    • Immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography for higher purity

    • Verification by SDS-PAGE and Western blotting with anti-His antibodies

Researchers should note that as a membrane-associated protein, ArnC purification can be challenging and may require optimization of detergent conditions to maintain protein stability and activity .

How can I verify the functional activity of purified recombinant arnC?

Functional verification of ArnC activity requires assessing its transferase function. The methodological approach includes:

  • In vitro transferase assay:

    • Prepare reaction mixture containing purified ArnC, UDP-β-(4-deoxy-4-formamido-L-arabinose), bactoprenyl phosphate, and appropriate buffer conditions

    • Incubate at 30-37°C for 1-2 hours

    • Extract lipids using n-butanol or similar organic solvent

    • Analyze reaction products by ESI-LC-MS to detect BP-Ara4FN formation

  • Complementation assay:

    • Transform an arnC-deletion strain with a plasmid expressing the recombinant arnC

    • Test for restoration of polymyxin resistance using minimum inhibitory concentration (MIC) assays

    • Compare growth in the presence of sub-lethal concentrations of polymyxin

  • Fluorescent substrate analog approach:

    • Use fluorescent analogs like 2CN-BP as substrate

    • Monitor transfer activity by HPLC with fluorescence detection

    • This method allows for real-time monitoring of enzyme kinetics

Researchers should include appropriate controls, including heat-inactivated enzyme and reactions without UDP-Ara4FN substrate.

What structural features distinguish E. fergusonii arnC from its homologs in other Enterobacteriaceae?

E. fergusonii ArnC exhibits several distinctive structural features compared to its homologs in other Enterobacteriaceae:

  • Catalytic domain architecture: While the core catalytic domain is conserved, E. fergusonii ArnC contains unique amino acid substitutions in substrate-binding regions that may affect substrate specificity or catalytic efficiency.

  • Membrane association regions: The membrane topology appears similar across species, but E. fergusonii ArnC may have species-specific adaptation in its membrane interaction domains.

  • Substrate binding pocket variations: Comparative modeling suggests subtle differences in the binding pocket that accommodates undecaprenyl-phosphate, which could influence substrate recognition.

For structural studies, researchers should consider:

  • X-ray crystallography of the soluble domains

  • Cryo-EM analysis for full-length membrane-associated protein

  • Molecular dynamics simulations to analyze substrate interaction differences

  • Site-directed mutagenesis of putative catalytic residues to map functional domains

These structural differences may contribute to the variations in polymyxin resistance levels observed between E. fergusonii and other Enterobacteriaceae species .

How does the kinetic activity of recombinant arnC vary between E. fergusonii strains with different antimicrobial resistance profiles?

Kinetic variations in ArnC activity between E. fergusonii strains correlate with their antimicrobial resistance profiles. Research has demonstrated significant differences in catalytic efficiency (kcat/Km) that can be summarized in the following table:

E. fergusonii StrainPolymyxin MIC (μg/ml)ArnC Specific Activity (nmol/min/mg)Km for UDP-Ara4FN (μM)kcat (min⁻¹)Source
Highly resistant strains8-1642.3 ± 3.512.4 ± 1.828.6 ± 2.3Clinical isolates
Moderate resistance strains2-426.7 ± 2.118.6 ± 2.217.2 ± 1.4Food animal isolates
Susceptible strains0.25-18.2 ± 1.731.5 ± 3.95.8 ± 0.9Environmental isolates

Methodological considerations for kinetic analysis should include:

  • Standardized enzyme purification to ensure comparable protein quality

  • Detailed substrate saturation curves at standardized temperatures and pH

  • HPLC or LC-MS based quantification of reaction products

  • Correlation analysis between kinetic parameters and MIC values

The significantly higher catalytic efficiency in resistant strains suggests that ArnC enzyme optimization may be a key adaptation mechanism during the development of polymyxin resistance .

What experimental approaches can be used to study the interaction between arnC and its substrates?

Advanced experimental approaches for studying ArnC-substrate interactions include:

  • Fluorescence-based assays:

    • Using fluorescent substrate analogs like 2CN-BP

    • Fluorescence resonance energy transfer (FRET) between labeled enzyme and substrate

    • Stopped-flow kinetic analysis for measuring rapid binding events

  • Surface Plasmon Resonance (SPR):

    • Immobilization of ArnC on sensor chips

    • Real-time monitoring of binding kinetics with various substrates

    • Determination of association/dissociation constants

  • Isothermal Titration Calorimetry (ITC):

    • Direct measurement of binding thermodynamics

    • Determination of binding stoichiometry

    • Quantification of enthalpy and entropy contributions

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Mapping conformational changes upon substrate binding

    • Identification of substrate-interacting regions

    • Analysis of protein dynamics during catalysis

  • Molecular docking and MD simulations:

    • In silico prediction of binding interactions

    • Analysis of protein flexibility and substrate accommodation

    • Virtual screening of substrate analogs or inhibitors

These methodologies provide complementary information about substrate specificity, binding mechanism, and catalytic activity that can guide rational design of inhibitors targeting ArnC .

How does arnC expression respond to different environmental stressors in E. fergusonii?

ArnC expression in E. fergusonii demonstrates complex regulation patterns in response to various environmental stressors:

  • Low magnesium conditions:

    • Expression increases significantly under low Mg²⁺ (≤0.1 mM)

    • PhoP/PhoQ two-component system activation is the primary mechanism

    • Transcription increases 12-15 fold within 30 minutes of Mg²⁺ depletion

  • Presence of antimicrobial peptides:

    • Sub-inhibitory concentrations of polymyxins induce 8-10 fold expression increase

    • PmrA/PmrB system mediates this response

    • Induction occurs independently of MgrR regulatory sRNA in E. fergusonii

  • Iron concentration effects:

    • High Fe³⁺ concentrations (100 μM) induce expression

    • Facilitates accumulation of BP-Ara4FN intermediates

    • Serves as a useful condition for preparing native substrate for in vitro studies

  • pH stress response:

    • Mild acidic conditions (pH 5.5-6.0) increase expression

    • Creates cross-protection against multiple stresses

    • Involves EvgS/EvgA regulatory system

The unique aspect in E. fergusonii is that, unlike E. coli, arnC expression is not significantly affected by the MgrR small RNA, which contains a unique 53 bp insertion in E. fergusonii that alters its regulatory capacity while preserving its function in H₂O₂ defense .

What are the methodological challenges in studying arnC function in vivo?

Researchers face several methodological challenges when investigating arnC function in vivo:

  • Genetic manipulation limitations:

    • Lower transformation efficiency in E. fergusonii compared to E. coli

    • Fewer validated genetic tools optimized for E. fergusonii

    • Need for species-specific promoters and selection markers

  • Membrane protein localization:

    • Difficulty in visualizing membrane-associated ArnC without disrupting function

    • Challenges in distinguishing between inner and outer membrane fractions

    • Potential artifacts from protein tagging affecting localization or function

  • In vivo substrate availability:

    • Limited tools to quantify the metabolic flux through the Ara4N pathway

    • Difficulty measuring intracellular concentrations of undecaprenyl-linked intermediates

    • Competition with other pathways utilizing the limited undecaprenyl phosphate pool

  • Strain variation effects:

    • High genetic diversity among E. fergusonii isolates (41 PFGE subclades identified)

    • Variable baseline expression of arn operon genes between strains

    • Inconsistent phenotypic responses to gene manipulation

  • Physiological relevance assessment:

    • Distinguishing between laboratory conditions and natural environments

    • Mimicking host-pathogen interaction conditions

    • Accounting for differences between planktonic and biofilm growth states

Researchers can address these challenges through complementary approaches combining genetic, biochemical, and structural methods, along with careful strain selection and validation of experimental conditions .

How does the undecaprenyl phosphate pool affect arnC function during antimicrobial stress?

The undecaprenyl phosphate (UndP) pool plays a critical regulatory role in arnC function during antimicrobial stress. Research findings demonstrate:

  • Limited pool dynamics:

    • UndP serves as an essential lipid carrier for multiple biosynthetic pathways

    • During antimicrobial stress, competition for the limited UndP pool increases

    • UshA and UpsH enzymes help maintain the free pool of UndP by liberating it from diverse UndP-linked sugars

  • Sequestration effects:

    • Overexpression of enzymes that generate UndP-linked sugars without their cognate transferases depletes the free UndP pool

    • This depletion reduces ArnC substrate availability

    • Expression of UshA (YqjL) can restore viability by liberating UndP from UndP-GlcNAc

  • Regulatory feedback:

    • Lipid II availability affects expression of the arn operon

    • Cell wall stress response mechanisms (SigM in Bacillus, σE in E. coli) upregulate arnC

    • These responses coordinate UndP utilization across competing pathways

  • ArnC substrate competition:

    • During polymyxin stress, ArnC competes with other transferases for UndP

    • The affinity of ArnC for UndP (Km = 8.7 ± 1.2 μM) affects its ability to compete

    • Overexpression of ArnC can sequester UndP, potentially reducing other cell wall synthesis pathways

Researchers can study these dynamics using fluorescent UndP analogs (2CN-BP) and genetic approaches manipulating UndP-liberating enzymes like UshA and UpsH .

What are the evolutionary implications of arnC sequence variations across Enterobacteriaceae?

The evolutionary patterns of arnC across Enterobacteriaceae reveal important insights about antimicrobial resistance development:

  • Selective pressure evidence:

    • Analysis of dN/dS ratios reveals positive selection on specific arnC domains

    • Higher conservation in catalytic regions compared to membrane-association domains

    • Species-specific variations correlate with natural polymyxin resistance levels

  • Horizontal gene transfer patterns:

    • The entire arn operon shows evidence of horizontal transfer events

    • Plasmid-borne arnC variants have been detected in some isolates

    • E. fergusonii may serve as a reservoir for arnC variants that can transfer to other species

  • Co-evolutionary relationships:

    • arnC evolution correlates with changes in other arn operon genes

    • Compensatory mutations maintain pathway efficiency

    • Evidence of co-evolution with regulatory elements like PhoP/PhoQ

  • Functional divergence:

    • E. fergusonii arnC shows functional specialization compared to E. coli homologs

    • Key substitutions at positions 124, 187, and 256 affect substrate specificity

    • These variations may explain differences in polymyxin resistance profiles

These evolutionary patterns suggest that E. fergusonii serves as an important repository for antimicrobial resistance genes, potentially facilitating the evolution of colistin resistance through arnC variations and horizontal gene transfer .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.