Recombinant Escherichia fergusonii Universal stress protein B (uspB)

What is Universal stress protein B (uspB) in Escherichia fergusonii?

Universal stress protein B (uspB) belongs to the universal stress protein (UspA) superfamily, a conserved group of proteins found across bacteria, archaea, and eukaryotes. In E. fergusonii, uspB functions similarly to the six usp genes identified in E. coli (uspA, -C, -D, -E, -F, and -G), which are triggered by various environmental stressors . The full amino acid sequence of E. fergusonii uspB is: MISTVALFWGLCVVCIINMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPNKQVRLVWYIYAQRYRDHHDEEFIRRCERVRRQFILTSALCGLVVISLIALLIWH .

How are universal stress proteins characterized in experimental settings?

Universal stress proteins are typically characterized through phenotypic analysis of deletion mutants. Researchers commonly employ the following methodological approach:

• Generate targeted gene deletions of the usp gene of interest

• Expose mutant strains to various environmental stressors (oxidative agents, pH changes, nutrient limitation)

• Compare phenotypic responses to wild-type strains

• Measure relevant parameters such as growth rate, survival percentage, and stress-specific biomarkers

This approach has revealed that USPs have both overlapping and distinct functions in stress response mechanisms .

What expression systems are most effective for producing recombinant uspB?

For successful expression of recombinant E. fergusonii uspB, researchers typically employ:

• Expression Vector Selection: pET-based vectors with T7 promoter systems offer high-yield expression

• Host Cell Optimization: BL21(DE3) E. coli strains are preferred for their reduced protease activity

• Induction Conditions: IPTG induction at 0.5-1.0 mM concentration when culture reaches OD600 0.6-0.8

• Temperature Management: Post-induction expression at 18-25°C often improves protein solubility

• Buffer Composition: Tris-based buffers with 50% glycerol are used for optimal storage

Storage recommendations include maintaining aliquots at -20°C for long-term storage and 4°C for working solutions up to one week .

How should experiments be designed to study uspB function in stress response?

When designing experiments to study uspB function in stress response, researchers should consider:

Experimental Structure:

• Between-subjects design: Different bacterial groups (wild-type vs. uspB deletion mutants) subjected to different treatments

• Within-subjects design: The same bacterial population evaluated under different stress conditions sequentially

Essential Controls:

• Wild-type strain (positive control)

• Deletion mutant complemented with functional uspB (rescue control)

• Deletion mutants of other USP family members for comparative analysis

• Vehicle controls for any chemical treatments

Key Methodological Considerations:

• Random assignment of bacterial cultures to treatment conditions to minimize bias

• Blinding of researchers during data collection and analysis

• Adequate sample sizes determined through power analysis

• Appropriate statistical approaches for data analysis

What are the recommended protocols for studying uspB in oxidative stress experiments?

Based on previous research with universal stress proteins, the following protocol framework is recommended:

Experimental Setup for Oxidative Stress Response:

• Culture Preparation:

  • Grow wild-type and uspB-deletion mutant strains to exponential phase

  • Normalize cell density across all experimental groups

• Stress Induction:

  • Expose cultures to superoxide-generating agents like phenazine methosulfate (PMS) at standardized concentrations

  • Include H₂O₂ exposure (typically 1-10 mM) as a comparative oxidative stressor

• Viability Assessment:

  • Measure survival at predetermined time points (0, 30, 60, 120 min)

  • Quantify using colony forming units (CFU) counts on selective media

  • Calculate survival percentage relative to time zero

• Data Analysis:

  • Apply appropriate statistical tests (t-test for two conditions, ANOVA for multiple conditions)

  • Generate survival curves to visualize time-dependent effects

  • Document any significant differences between wild-type and mutant strains

How can researchers accurately distinguish between uspB functions and those of other USP family members?

To accurately distinguish between uspB functions and those of other USPs:

• Generate Multiple Mutant Combinations:

  • Create single, double, and triple deletion mutants encompassing various USP combinations

  • Include a complete USP-family deletion mutant as reference

• Perform Complementation Analysis:

  • Reintroduce individual USP genes into multiple deletion backgrounds

  • Use inducible promoters to control expression levels

• Conduct Phenotypic Testing Panels:

  • Assess multiple stress conditions simultaneously (oxidative, iron limitation, motility, adhesion)

  • Document potential additive effects between uspB and other USPs

• Employ Molecular Interaction Studies:

  • Use pull-down assays to identify protein-protein interactions

  • Apply chromatin immunoprecipitation to reveal DNA-binding activity

  • Implement transcriptome analysis to identify target genes

How should researchers interpret contradictory data regarding uspB function across different experimental conditions?

When facing contradictory results in uspB functional studies, researchers should:

• Systematically Analyze Experimental Variables:

  • Growth phase differences: USP functions may vary between exponential and stationary phases

  • Media composition variations: Different nutrient environments can alter stress response mechanisms

  • Strain-specific effects: Clinical vs. laboratory strains may show different USP dependencies

• Evaluate Experimental Design Limitations:

  • Sample sizes: Insufficient replicates may lead to statistical anomalies

  • Control adequacy: Absence of proper controls can produce misleading results

  • Technical variations: Different measurement techniques may produce divergent outcomes

• Apply Comprehensive Statistical Analysis:

  • Conduct meta-analysis when multiple datasets are available

  • Implement statistical approaches suitable for heterogeneous data

  • Consider Bayesian methods to incorporate prior knowledge

• Document Self-Contradictions:

  • Clearly report contradictory findings rather than selectively presenting data

  • Propose mechanistic explanations for context-dependent differences

  • Suggest experimental approaches to resolve contradictions

What methodologies are most effective for analyzing uspB interactions with cellular iron regulation pathways?

For studying uspB's potential role in iron regulation, researchers should:

• Investigate Iron-Dependent Stress Responses:

  • Streptonigrin sensitivity assays: Test wild-type vs. uspB mutants as streptonigrin toxicity correlates with intracellular iron concentration

  • Iron chelator experiments: Evaluate growth under iron limitation conditions

  • Siderophore production measurement: Quantify iron-scavenging compounds

• Analyze Iron-Responsive Gene Expression:

  • Measure transcription of iron-regulatory genes in uspB mutants

  • Implement RNA-seq to identify global transcriptional changes

  • Use qPCR to validate key iron metabolism gene expression levels

• Assess Direct Iron Interactions:

  • Apply isothermal titration calorimetry to measure binding affinities

  • Use electron paramagnetic resonance to detect iron coordination

  • Implement metal-catalyzed oxidation assays to identify iron-binding sites

• Experimental Design Considerations:

  • Control medium iron concentration precisely

  • Include multiple iron-dependent phenotypic assays

  • Compare uspB mutants with known iron metabolism mutants

What approaches should be used to characterize the structure-function relationship of uspB?

To establish structure-function relationships for uspB:

• Structural Analysis Methods:

  • X-ray crystallography: Determine high-resolution protein structure

  • NMR spectroscopy: Analyze structural dynamics in solution

  • Cryo-EM: Visualize potential larger complexes involving uspB

  • Molecular dynamics simulations: Model protein behavior in different environments

• Functional Domain Mapping:

  • Generate truncated protein variants

  • Create site-directed mutants at conserved residues

  • Perform alanine-scanning mutagenesis

• Protein-Protein Interaction Analysis:

  • Yeast two-hybrid screening

  • Co-immunoprecipitation followed by mass spectrometry

  • Biolayer interferometry to measure binding kinetics

• Data Integration Approach:

  • Correlate structural features with phenotypic outcomes

  • Use bioinformatics to compare uspB structural elements across species

  • Apply machine learning to predict functional impacts of structural variations

How can researchers optimize expression and purification of recombinant E. fergusonii uspB for structural studies?

For optimal expression and purification of recombinant E. fergusonii uspB:

Expression Optimization:

• Codon Optimization: Adjust codons based on expression host preference

• Fusion Tags Selection: Test multiple tags (His6, GST, MBP) to identify optimal solubility enhancement

• Expression Conditions Matrix:

Purification Protocol:

• Cell lysis in Tris buffer (pH 8.0) with protease inhibitors

• Initial capture via affinity chromatography

• Tag removal with specific protease

• Polish via ion exchange and size exclusion chromatography

• Quality assessment via SDS-PAGE and mass spectrometry

• Storage in Tris-based buffer with 50% glycerol at -20°C

What statistical approaches are most appropriate for analyzing uspB expression data under various stress conditions?

When analyzing uspB expression data:

• Data Preprocessing:

  • Normalize expression values (RPKM, TPM, or similar methods)

  • Transform data appropriately (log transformation for skewed distributions)

  • Test for normality and homoscedasticity

• Statistical Test Selection:

  • For comparing two conditions: paired or unpaired t-tests, or non-parametric alternatives

  • For multiple conditions: one-way or multi-way ANOVA with appropriate post hoc tests

  • For time-course experiments: repeated measures ANOVA or mixed models

• Multiple Testing Correction:

  • Apply Benjamini-Hochberg procedure for controlling false discovery rate

  • Use Bonferroni correction when strict control of family-wise error rate is needed

  • Report both unadjusted and adjusted p-values for transparency

• Visualization Approaches:

  • Generate heat maps for multi-condition comparisons

  • Use box plots or violin plots to show data distribution

  • Create time-series plots for temporal expression patterns

How can researchers effectively generate and validate uspB knockout mutants in E. fergusonii?

For generating and validating uspB knockout mutants:

Generation Methods:

• CRISPR-Cas9 System:

  • Design sgRNAs targeting uspB with minimal off-target effects

  • Include homology-directed repair template with selectable marker

  • Transform E. fergusonii with CRISPR-Cas9 and template components

• Lambda Red Recombination:

  • Generate PCR products with antibiotic resistance cassette flanked by homology regions

  • Express Lambda Red proteins in E. fergusonii

  • Select recombinants on appropriate antibiotics

Validation Protocol:

• Genotypic Confirmation:

  • PCR verification of gene deletion

  • Sanger sequencing of junction regions

  • Whole-genome sequencing to confirm single deletion

• Transcriptional Validation:

  • RT-PCR to confirm absence of uspB transcript

  • RNA-seq to assess potential polar effects

• Protein-Level Verification:

  • Western blot using anti-uspB antibodies

  • Proteomics analysis to confirm absence of uspB protein

• Functional Complementation:

  • Reintroduce wild-type uspB gene

  • Verify restoration of phenotype

  • Include point mutants as negative controls

How can uspB research contribute to understanding antimicrobial resistance mechanisms in E. fergusonii?

UspB research may contribute to antimicrobial resistance studies through:

• Stress Response Connection:

  • Investigate whether uspB upregulation correlates with antibiotic exposure

  • Determine if uspB deletion affects minimum inhibitory concentrations

  • Study the relationship between oxidative stress response and antibiotic tolerance

• Mobile Genetic Element Associations:

  • Examine uspB proximity to resistance determinants on mobile genetic elements

  • Study uspB expression changes in strains harboring plasmid-mediated resistance

  • Analyze uspB regulation in mcr-1 positive isolates

• Biofilm Formation Role:

  • Evaluate uspB contribution to biofilm development

  • Test whether biofilm-associated antibiotic tolerance requires uspB

  • Compare single and multiple USP mutants for biofilm phenotypes

• Experimental Approaches:

  • Transcriptomic profiling under antibiotic pressure

  • Proteomics analysis of membrane changes

  • Evolution experiments to track uspB mutations during resistance development

What are promising research directions for understanding the evolutionary conservation of uspB across Enterobacteriaceae?

Future research directions for evolutionary studies of uspB include:

• Comparative Genomics Approaches:

  • Perform phylogenetic analysis of uspB across Enterobacteriaceae species

  • Identify conserved domains and variable regions

  • Map selection pressures across the gene sequence

• Functional Conservation Testing:

  • Conduct cross-species complementation experiments

  • Test heterologous expression of uspB variants in model systems

  • Assess functional conservation in diverse stress environments

• Structural Comparison:

  • Determine crystal structures from multiple species

  • Compare protein-folding dynamics across homologs

  • Identify structural determinants of species-specific functions

• Innovative Methodologies:

  • Apply ancestral sequence reconstruction to trace uspB evolution

  • Implement directed evolution to identify functional constraints

  • Use deep mutational scanning to map variant effects

How can researchers address technical challenges in uspB protein expression and solubility?

Common uspB expression challenges and solutions:

Additional approaches:

• Test expression in cell-free systems for toxic proteins

• Consider periplasmic expression for certain constructs

• Implement high-throughput screening of expression conditions

What strategies help resolve contradictory results in uspB stress response studies?

To resolve contradictory findings in uspB research:

• Standardize Experimental Conditions:

  • Develop consensus protocols for stress response assays

  • Define standard growth conditions and media formulations

  • Establish uniform stress agent concentrations and exposure times

• Implement Robust Controls:

  • Include multiple reference strains

  • Verify phenotypes with complementation constructs

  • Test known stress-sensitive mutants as positive controls

• Apply Complementary Methodologies:

  • Combine genetic, biochemical, and physiological approaches

  • Utilize both in vitro and in vivo methodologies

  • Implement different measurement techniques for key parameters

• Collaborative Verification:

  • Establish multi-laboratory validation studies

  • Share reagents and strains between research groups

  • Implement blind testing protocols