Recombinant Escherichia fergusonii UPF0059 membrane protein yebN (yebN)

Shipped with Ice Packs
In Stock

Description

Expression System

  • Host: E. coli (BL21 or JM109 strains)

  • Vector: pET-based plasmids with T7 promoter .

  • Induction: IPTG-mediated .

Purification and Stability

  • Purification: Ni-chelating affinity chromatography .

  • Yield: ~0.1–1.0 mg/mL after reconstitution .

  • Storage: Lyophilized powder stable at -20°C/-80°C; working aliquots at 4°C for ≤1 week .

Biological Role

  • Metal Ion Transport: Functions as a manganese efflux pump (MntP), maintaining intracellular metal homeostasis .

  • Antibiotic Resistance: Co-occurrence with multidrug efflux systems (e.g., AcrAB-TolC) in E. fergusonii resistomes .

Mechanistic Studies

  • Fusion Protein Applications: Used in Sec-dependent secretion systems for extracellular protein export (e.g., preYebF-ACP fusions) .

  • Membrane Localization: Predicted orientation via OPM and PDBTM annotations, though no experimental structure exists .

Research Applications

ApplicationDescription
SDS-PAGE AnalysisPrimary quality control method for purity assessment .
Metal Transport StudiesInvestigated in E. fergusonii strains under manganese stress .
Antibiotic ResistanceLinked to genomic islands in pathogenic E. fergusonii isolates .

Comparative Analysis of Production Systems

ParameterE. coli Yeast Cell-Free
YieldModerate (mg/L)High (e.g., 90 mg/L)Low to moderate
Post-Translational ModsNoneGlycosylation possibleLimited
CostLowModerateHigh
Speed12–24 hrs48–72 hrs<6 hrs

Challenges and Future Directions

  • Structural Biology: Lack of crystallographic data limits mechanistic insights .

  • Pathogenicity Links: Role in E. fergusonii virulence remains underexplored .

  • Biotech Applications: Potential use in metal biosensors or antibiotic adjuvants .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of your specified tag.
Synonyms
mntP; yebN; EFER_1254; Probable manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
mntP
Target Protein Sequence
MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGIRGGDDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGPILGKKAEILGGLVLIGIGVQ ILWTHFHG
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the YebN protein and what is its primary function?

YebN (also known as mntP) is a membrane protein that functions as a manganese (Mn²⁺) efflux system. Research on homologous proteins in bacteria such as Xanthomonas oryzae pv. oryzae (Xoo) has demonstrated that YebN plays a crucial role in manganese homeostasis by exporting excess Mn²⁺ from the bacterial cell . The protein has been identified as a novel metal export system essential for maintaining proper manganese levels, which impacts oxidative stress management, hypo-osmotic stress resistance, and virulence in pathogenic bacteria .

In Escherichia fergusonii, YebN is classified as a UPF0059 family membrane protein . While the specific function of E. fergusonii YebN hasn't been as thoroughly characterized as its homologs in other species, similar proteins suggest its primary role involves manganese export and metal ion homeostasis.

What is the relationship between YebN structure and function?

The relationship between YebN structure and function centers on its ability to transport manganese ions across bacterial membranes. As a membrane protein, YebN's transmembrane domains create a pathway for manganese efflux, while its cytoplasmic regions appear to regulate transport activity .

The cytoplasmic regions of YebN contain amino acids crucial for manganese tolerance. Studies utilizing point mutations have shown that substitutions at positions G25, A26, A27, D35, and G167 alter the protein's ability to confer manganese resistance . This suggests these residues may be involved in manganese binding, conformational changes necessary for transport, or interactions with regulatory proteins.

Despite lacking homology to known metal transporters, YebN's DUF204 domains appear fundamental to its metal transport function. The unique structural features of YebN represent a novel mechanism for metal efflux, distinct from previously characterized systems . This structure-function relationship makes YebN an intriguing subject for researchers studying diverse mechanisms of bacterial metal homeostasis.

How does YebN expression respond to environmental conditions?

YebN expression exhibits notable responsiveness to environmental manganese levels. Research has demonstrated that expression of the yebN gene is positively regulated by manganese ions (Mn²⁺) and the manganese-dependent transcription regulator MntR . This creates a regulatory feedback loop where elevated manganese concentrations induce YebN expression, leading to increased manganese export to maintain cellular homeostasis.

This regulatory mechanism allows bacteria to dynamically adjust their manganese efflux capacity based on environmental metal concentrations. When bacteria encounter high manganese levels, YebN expression increases, enhancing their ability to export excess manganese and prevent toxicity. Conversely, under manganese-limited conditions, reduced YebN expression helps conserve this essential micronutrient.

The transcriptional control of YebN by MntR represents a coordinated approach to manganese homeostasis, integrating YebN-mediated efflux with other components of bacterial metal regulation systems . This responsive expression pattern highlights the sophisticated mechanisms bacteria have evolved to maintain optimal intracellular metal concentrations across varying environmental conditions.

How does YebN contribute to manganese homeostasis in bacteria?

YebN plays a crucial role in bacterial manganese homeostasis through its function as a manganese (Mn²⁺) efflux system. Research on YebN in Xanthomonas oryzae pv. oryzae (Xoo) has revealed several key aspects of this function :

  • Manganese export capability: When YebN is deleted (ΔyebN mutant), bacteria accumulate significantly higher intracellular manganese levels. Specifically, the yebN mutant accumulated four-fold more intracellular manganese than the wild-type strain when grown in medium containing 0.15 mM manganese .

  • Manganese sensitivity: The ΔyebN mutant shows pronounced growth defects when exposed to elevated manganese concentrations. While wild-type bacteria can grow in media supplemented with 1 mM or even 5 mM Mn²⁺ (albeit more slowly at the higher concentration), the ΔyebN mutant fails to grow under these conditions .

  • Metal specificity: YebN appears to be specific for manganese, as the ΔyebN mutant did not show differential sensitivity to other metal ions including iron, copper, cobalt, nickel, cadmium, and zinc compared to wild-type bacteria .

  • Regulatory feedback: Expression of the yebN gene is positively regulated by Mn²⁺ and the Mn²⁺-dependent transcription regulator MntR . This creates a feedback loop where elevated manganese levels induce YebN expression, leading to increased manganese export.

This manganese homeostasis function is critical for bacterial physiology, as manganese serves as an important cofactor for various enzymes and plays a role in protection against oxidative stress. By regulating intracellular manganese levels, YebN helps bacteria maintain optimal cellular functions while avoiding manganese toxicity.

What is the relationship between YebN function and oxidative stress response?

YebN plays a complex and seemingly paradoxical role in bacterial oxidative stress response, intricately linked to its function in manganese homeostasis. Research on the ΔyebN mutant in Xanthomonas oryzae pv. oryzae (Xoo) revealed fascinating relationships between YebN, manganese levels, and oxidative stress resistance :

  • Conditional oxidative stress resistance: The ΔyebN mutant showed differential responses to oxidative stress depending on environmental manganese concentrations:

    • In low Mn²⁺ medium, the ΔyebN mutant was more tolerant to methyl viologen and H₂O₂ (oxidative stress agents) than the wild-type strain .

    • In high Mn²⁺ medium, the ΔyebN mutant was more sensitive to these oxidative stress agents .

  • Manganese-dependent ROS detoxification: These observations suggest that YebN plays an important role in both Mn²⁺ homeostasis and detoxification of reactive oxygen species (ROS) . Manganese is known to function as a cofactor for superoxide dismutase and other antioxidant enzymes, which could explain part of this relationship.

  • Balancing act: The data implies that the relationship between manganese levels and oxidative stress resistance requires precise regulation. Too little manganese may impair antioxidant enzyme function, while excessive manganese could potentially become toxic or interfere with other cellular processes.

This complex relationship highlights how YebN-mediated manganese efflux balances cellular metal content for optimal defense against oxidative stress. It suggests that YebN's role extends beyond simple metal export to influence how bacteria respond to and survive oxidative stress conditions, which are commonly encountered during host infection or environmental challenges.

What is the role of YebN in bacterial virulence mechanisms?

YebN plays a significant role in bacterial virulence, as demonstrated by research on Xanthomonas oryzae pv. oryzae (Xoo), the causative agent of bacterial leaf blight in rice :

  • Reduced virulence in mutants: Mutation of the yebN gene substantially reduced both the growth rate of Xoo and its ability to form lesions in rice plants . This indicates that YebN is required for full virulence of this bacterial pathogen.

  • Host colonization and fitness: The growth defects observed in the ΔyebN mutant suggest that YebN is involved in bacterial fitness within the host environment . This could relate to the ability of the bacteria to proliferate and establish successful infection.

  • Stress resistance during infection: YebN contributes to bacterial resistance against various stresses encountered during host infection:

    • Oxidative stress: YebN helps manage ROS detoxification, which is crucial as pathogens frequently encounter oxidative bursts as part of host defense mechanisms .

    • Hypo-osmotic shock: YebN provides protection against hypo-osmotic stress , which bacteria may experience during transition between different host environments or tissues.

  • Metal homeostasis during pathogenesis: By regulating manganese levels, YebN may help pathogens maintain optimal metal concentrations during infection, where metal availability can fluctuate and hosts may attempt to sequester essential metals as an antimicrobial strategy.

The importance of YebN in virulence highlights the complex relationship between metal homeostasis and host-pathogen interactions . It suggests that targeting metal transport systems like YebN could potentially provide new strategies for controlling bacterial infections.

What are the critical amino acid residues for YebN function?

Research on YebN has identified several critical amino acid residues in the cytoplasmic regions of the protein that are essential for its function in manganese efflux and tolerance. Studies using point mutations in YebN have revealed specific residues of particular importance :

  • Key cytoplasmic residues: Specific amino acids in the cytoplasmic regions of YebN were found to be crucial for its function, including:

    • G25 (Glycine at position 25)

    • A26 (Alanine at position 26)

    • A27 (Alanine at position 27)

    • D35 (Aspartic acid at position 35)

    • G167 (Glycine at position 167)

  • Functional impact of mutations: When these amino acids were substituted (e.g., G25A, A26N, A27N, A27ND35A, and G167A), the resulting mutant proteins showed altered ability to confer manganese tolerance . This indicates these residues play important roles in the manganese export function of YebN.

The identification of these critical residues provides insight into the structure-function relationship of YebN. These amino acids may be involved in manganese binding, conformational changes necessary for transport, or interactions with other components of the manganese homeostasis machinery. Understanding the specific roles of these residues could facilitate the development of targeted interventions to modulate YebN function in pathogenic bacteria.

How does YebN contribute to bacterial resistance to hypo-osmotic shock?

One of the more unexpected findings about YebN is its role in protecting bacteria against hypo-osmotic shock. Research on Xanthomonas oryzae pv. oryzae (Xoo) revealed important insights into this function :

  • Increased sensitivity in mutants: Deletion of the yebN gene rendered Xoo sensitive to hypo-osmotic shock . This suggests that YebN plays a protective role when bacteria experience sudden decreases in environmental osmolarity.

  • Potential mechanisms: While the exact mechanism by which YebN confers resistance to hypo-osmotic shock was not fully elucidated in the search results, several possibilities exist:

    • Regulation of ion fluxes: As a metal transporter, YebN may participate in broader ion homeostasis processes that help bacteria adjust to osmotic changes.

    • Membrane stability: YebN's presence in the membrane might contribute to membrane integrity or properties that help withstand osmotic pressure changes.

    • Indirect effects through metal homeostasis: Proper manganese levels maintained by YebN might be necessary for the function of other proteins involved in osmotic stress responses.

  • Connection to virulence: This hypo-osmotic shock resistance function could be particularly important during host infection, as pathogens may encounter varying osmotic conditions in different host tissues or during transitions between environments.

The dual functionality of YebN in both metal homeostasis and hypo-osmotic stress resistance represents an interesting example of how bacteria can evolve proteins with multifaceted roles that contribute to both normal physiology and stress adaptation. This functional versatility may be particularly advantageous for pathogenic bacteria that must navigate diverse host environments.

What are the optimal expression systems for recombinant YebN production?

Based on the available information, several recommendations can be made regarding expression systems for recombinant YebN production :

  • E. coli as expression host: Recombinant full-length Escherichia fergusonii UPF0059 membrane protein yebN was successfully expressed in E. coli . This suggests E. coli is a viable expression system for this protein.

  • Tag considerations: The recombinant protein was produced with an N-terminal His tag , which facilitates purification using affinity chromatography. This tagging strategy appears effective for YebN expression and purification.

  • Expression conditions: For optimal expression of membrane proteins like YebN, researchers should consider:

    • Using E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Temperature optimization (lower temperatures often improve membrane protein folding)

    • Induction conditions optimization (inducer concentration and induction timing)

  • Protein preparation: The recombinant YebN is typically prepared as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, adding 5-50% of glycerol (final concentration) is recommended .

  • Storage considerations: Store working aliquots at 4°C for up to one week. For longer storage, keep at -20°C/-80°C and avoid repeated freeze-thaw cycles as these can damage the protein .

These guidelines provide a starting point for researchers seeking to produce recombinant YebN for structural or functional studies. Optimization may be necessary depending on the specific experimental requirements and downstream applications.

How can researchers measure YebN-mediated manganese efflux?

Based on the research approaches described in the search results, several methods can be employed to measure and characterize YebN-mediated manganese efflux :

  • Intracellular manganese measurement by ICP-MS:

    • Inductively coupled plasma mass spectrometry (ICP-MS) was used to measure intracellular manganese concentrations in wild-type and ΔyebN mutant strains .

    • This approach revealed that the yebN mutant accumulated four-fold more intracellular manganese than the wild-type strain when grown in medium containing 0.15 mM manganese .

    • The technique provides quantitative data on metal accumulation, directly demonstrating YebN's role in manganese export.

  • Growth assays in manganese-supplemented media:

    • Bacterial strains (wild-type, ΔyebN mutant, and complemented strains) can be cultured in media with varying manganese concentrations to assess manganese tolerance .

    • Both solid (agar plates) and liquid media approaches can be used, with growth monitored by colony formation or optical density measurements (OD600) .

    • These assays provide functional evidence of YebN's role in manganese efflux through the differential growth patterns observed.

  • Complementation studies:

    • Creating complemented strains by reintroducing wild-type or mutant yebN genes into the ΔyebN background .

    • This approach can confirm that observed phenotypes are specifically due to yebN deletion and can also be used to study the effects of specific mutations on YebN function.

  • Mn²⁺-responsive reporter systems:

    • Developing fluorescent or luminescent reporters responsive to intracellular manganese levels can provide real-time monitoring of manganese homeostasis.

    • These systems can be particularly useful for high-throughput screening or dynamic studies of manganese efflux.

These methodological approaches provide robust ways to assess and characterize YebN's function as a manganese efflux system, allowing researchers to quantify manganese transport activity and identify factors that influence this process.

What are the recommended methods for YebN mutagenesis studies?

The search results provide insights into YebN mutagenesis approaches that have been successful in previous research . Based on this information, several methods can be recommended for YebN mutagenesis studies:

  • Site-directed mutagenesis for specific amino acid changes:

    • This approach was used to create point mutations in the cytoplasmic regions of YebN (e.g., G25A, A26N, A27N, A27ND35A, and G167A) to study their effects on protein function .

    • These studies successfully identified amino acids critical for YebN's manganese tolerance function.

  • In-frame deletion construction:

    • An in-frame deletion mutant (ΔyebN) was constructed to study the effects of complete YebN absence .

    • This approach allowed researchers to characterize the phenotypes associated with loss of YebN function.

  • Complementation studies:

    • Complemented strains (e.g., C-ΔyebN) were created by reintroducing the wild-type yebN gene into the deletion mutant .

    • This confirmed that the observed phenotypes were specifically due to yebN deletion rather than polar effects or secondary mutations.

    • The pHM1 vector was used as a vehicle for introducing wild-type and mutant yebN sequences for complementation studies .

  • Testing functionality through phenotypic assays:

    • The functionality of wild-type and mutant YebN proteins was assessed through manganese tolerance assays, comparing growth in media with and without manganese supplementation .

    • This provided a straightforward readout of YebN function following mutagenesis.

MutationEffect on Mn²⁺ ToleranceResearch Significance
G25AAltered toleranceIdentifies critical residue in cytoplasmic region
A26NAltered toleranceDemonstrates importance of amino acid properties in this position
A27NAltered toleranceShows functional significance of this residue
A27ND35AAltered toleranceReveals potential interaction between these residues
G167AAltered toleranceIdentifies importance of C-terminal cytoplasmic region

These approaches have proven effective for studying YebN structure-function relationships and could serve as recommended methods for future mutagenesis studies of this protein.

How should researchers design experiments to assess YebN's role in pathogenicity?

Based on the research approaches described in the search results, several experimental designs can be recommended to assess YebN's role in pathogenicity :

  • In vivo infection models:

    • Plant infection assays: For phytopathogens like Xanthomonas oryzae pv. oryzae, comparing the ability of wild-type, ΔyebN mutant, and complemented strains to cause disease in host plants (e.g., rice) .

    • Quantitative measurements of lesion formation to assess virulence levels .

    • Bacterial growth monitoring within host tissues to evaluate in vivo fitness.

  • Stress resistance assays relevant to host environments:

    • Oxidative stress tolerance: Testing bacterial resistance to compounds like methyl viologen and H₂O₂ at different manganese concentrations .

    • Hypo-osmotic shock resistance: Evaluating survival following sudden decreases in osmolarity .

    • These assays help connect YebN's cellular functions to conditions encountered during host infection.

  • Metal homeostasis during infection:

    • Measuring intracellular metal concentrations (particularly manganese) during different stages of infection using ICP-MS .

    • Comparing metal acquisition abilities between wild-type and ΔyebN strains in host-mimicking conditions.

  • Gene expression studies:

    • Analyzing yebN expression patterns during infection using techniques like qRT-PCR.

    • Studying how MntR and manganese levels regulate yebN expression during pathogenesis .

  • Comprehensive virulence factor analysis:

    • Assessing how YebN affects the expression or activity of other known virulence factors.

    • Determining if YebN deletion alters secretion systems or other pathogenicity mechanisms.

These experimental designs collectively provide a comprehensive approach to understanding YebN's role in pathogenicity, connecting its molecular functions to bacterial fitness and virulence in host environments.

How can researchers investigate the relationship between YebN and oxidative stress response?

To investigate the complex relationship between YebN and oxidative stress response, researchers should consider the following methodological approaches :

  • Differential oxidative stress challenge experiments:

    • Challenge wild-type, ΔyebN mutant, and complemented strains with oxidative stress agents (H₂O₂, methyl viologen) under varying manganese concentrations .

    • Measure survival rates or growth inhibition to quantify stress resistance.

    • This approach can reveal the conditional nature of YebN's influence on oxidative stress resistance.

  • ROS measurement assays:

    • Use fluorescent dyes (e.g., DCFH-DA, DHE) to measure intracellular ROS levels in different strains under various conditions.

    • Compare ROS accumulation in wild-type and ΔyebN mutants following oxidative stress exposure.

    • These measurements can help determine if YebN affects ROS generation or detoxification.

  • Antioxidant enzyme activity assays:

    • Measure the activity of manganese-dependent enzymes like superoxide dismutase (SOD) in wild-type versus ΔyebN mutants.

    • Determine if altered manganese homeostasis in ΔyebN affects the function of these critical antioxidant enzymes.

  • Gene expression analysis:

    • Examine the expression of oxidative stress response genes in wild-type versus ΔyebN backgrounds.

    • Determine if YebN influences stress-responsive transcriptional programs.

  • In vivo oxidative stress during infection:

    • Develop methods to measure oxidative stress responses during actual host infection.

    • Compare the ability of wild-type and ΔyebN mutants to counter host-generated ROS during pathogenesis.

These methodological approaches can help unravel the mechanistic connections between YebN-mediated manganese efflux and bacterial oxidative stress responses. Understanding these relationships may reveal new insights into how pathogens balance metal homeostasis with defense against oxidative stress during host colonization and infection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.