Recombinant Escherichia fergusonii UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Description

General Information

The YfbV protein is a membrane protein found in Escherichia coli and related bacteria. While the precise function of YfbV remains largely unknown, studies suggest its involvement in essential cellular processes. Specifically, research indicates that in E. coli, YfbV, also known as YmgF, interacts with multiple cell division proteins and localizes to the division septum during cell division .

Characteristics of YmgF in E. coli

YmgF is a 72-residue integral membrane protein. It was found to associate with many E. coli cell division proteins and to localize to the E. coli division septum in an FtsZ-, FtsA-, FtsQ-, and FtsN-dependent manner .

  • YmgF interacts with Fts proteins .

  • YmgF is not essential for cell viability, but when overexpressed, YmgF can overcome the thermosensitive phenotype of the ftsQ1(Ts) mutation and restore its viability under low-osmolarity conditions .

  • YmgF might be a novel component of the E. coli cell division machinery .

YmgF Association with E. coli Cell Division Machinery

YmgF can efficiently interact in vivo with two other E. coli cell division proteins, FtsI and FtsQ . YmgF was able to dimerize and appeared to associate with essentially all the tested E. coli cell division proteins (FtsA, FtsB, FtsI, FtsL, FtsN, FtsW, FtsX, and FtsZ), albeit with different efficiencies .

Escherichia fergusonii

Escherichia fergusonii is a gram-negative, rod-shaped bacterium belonging to the Enterobacteriaceae family . This bacterium can infect humans, leading to severe illnesses such as urinary tract infections, cystitis, biliary tract infections, pneumonia, meningitis, and hemolytic uremic syndrome, and can potentially result in death . The rise of antibiotic resistance, including resistance to last-resort drugs like colistin, has complicated the treatment of E. fergusonii infections .

MgrR sRNA in Escherichia fergusonii

  • MgrR contains a unique 53 bp insertion in Escherichia fergusonii, a close relative of Escherichia coli and Salmonella enterica .

  • The insertion is a repetitive extragenic palindromic (REP) sequence that could block transcription, but full-length MgrR is produced in E. fergusonii, showing that the insertion has not affected sRNA production .

  • Deletion of mgrR made E. fergusonii more susceptible to H$$_2$$O$$_2$$ .

  • MgrR improves E. fergusonii's H$$_2$$O$$_2$$ resistance .

Multi-Epitope Vaccine Design Against Escherichia fergusonii

Given the increasing antibiotic resistance, a study aimed to design a multi-epitope vaccine against E. fergusonii . The approach involved:

  • Retrieving the complete proteome of all known strains .

  • Filtering for surface-exposed virulent proteins . Seventeen virulent proteins (4 extracellular, 4 outer membranes, 9 periplasmic) with desirable physicochemical properties were identified from the complete proteome of known strains .

  • Mapping B-cell and T-cell epitopes .

  • Evaluating epitopes for antigenicity, allergenicity, solubility, MHC-binding, and toxicity .

  • Fusing filtered epitopes with specific linkers and an adjuvant into a vaccine construct .

  • Predicting and refining the vaccine candidate structure . The refined structure showed 78.1% amino acids in allowed regions and a VERIFY3D score of 81% .

  • Docking the vaccine construct with TLR-4, MHC-I, and MHC-II, which showed significant binding energies and interactions .

  • Conducting molecular dynamic simulations, which indicated a stable nature of the docked complexes in terms of intermolecular binding conformation and interactions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yfbV; EFER_0874; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
yfbV
Target Protein Sequence
MSTPDDRSVNFFSLFRRGQHYSKTWPMEKRLAPVFVENRVIRMTRYAIRFMPPIAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQDAGQVL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0208 membrane protein YfbV and in which organisms is it found?

UPF0208 membrane protein YfbV is a bacterial membrane protein consisting of 151 amino acids that has been identified in several Enterobacteriaceae species, particularly within the Escherichia genus. This protein has been characterized in Escherichia coli O45:K1, Escherichia fergusonii, and Salmonella enterica subspecies . YfbV belongs to a protein family conserved through evolution and appears to play a role in chromosome organization, specifically in processes related to the Ter macrodomain isolation . The protein has been designated as part of the UPF (Uncharacterized Protein Family) 0208, indicating that while its structure may be known, its precise biological function was initially uncharacterized or only partially understood.

How is recombinant YfbV typically expressed and purified?

Recombinant YfbV is typically expressed in E. coli expression systems with a fusion tag to facilitate purification. Based on available protocols, the following methodology is commonly employed:

  • Expression System: The protein is commonly expressed as a recombinant construct in E. coli with an N-terminal His-tag fusion .

  • Expression Conditions: While specific conditions may vary between laboratories, the protein is expressed in E. coli under controlled conditions that optimize membrane protein production while minimizing cellular stress responses.

  • Purification Process: Affinity chromatography using the His-tag is the primary purification method, followed potentially by size exclusion chromatography or other techniques to achieve high purity (>90% as determined by SDS-PAGE) .

  • Final Format: The purified protein is typically provided as a lyophilized powder in a storage buffer consisting of Tris/PBS-based solution with 6% trehalose at pH 8.0 . For long-term storage, the addition of 50% glycerol and storage at -20°C/-80°C is recommended .

  • Reconstitution: For experimental use, the protein is reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with glycerol added to prevent freeze-thaw damage .

What cellular functions has YfbV been implicated in, particularly regarding chromosome organization?

YfbV has been implicated in a critical site-specific system that constrains the Ter macrodomain (MD) of the bacterial chromosome. Research indicates that YfbV works in conjunction with specific 12-bp sequences located in the flanking Left and Right macrodomains to prevent the spread of a constraining process from the Ter region to the rest of the chromosome . This function appears essential for proper chromosome organization during cell division.

The protein has been identified as conserved with MatP through evolution, suggesting its role in chromosome organization is fundamental and preserved across various bacterial species . The specific mechanism by which YfbV restricts the consequences of anchoring the Ter MD to the division machinery represents a sophisticated level of chromosome structural regulation that impacts bacterial cell division processes.

What are the challenges and physiological consequences of expressing membrane proteins like YfbV in E. coli?

Overexpression of membrane proteins in E. coli, including proteins like YfbV, presents significant technical challenges with physiological consequences that can impact experimental outcomes. Studies examining the consequences of membrane protein overexpression have revealed several key issues:

  • Saturation of Membrane Protein Translocation Machinery: Overexpression of membrane proteins frequently leads to saturation of the cytoplasmic membrane protein translocation machinery, resulting in accumulation of cytoplasmic aggregates containing:

    • The overexpressed membrane proteins

    • Chaperones (DnaK/J and GroEL/S)

    • Soluble proteases (HslUV and ClpXP)

    • Precursors of periplasmic and outer membrane proteins

  • Impaired Protein Secretion: The accumulation of precursors correlates with reduced levels of secreted proteins, directly impacting cellular function .

  • Disruption of Respiratory Chain Complexes: Importantly, overexpression of membrane proteins leads to strongly reduced accumulation levels of respiratory chain complexes in the cytoplasmic membrane .

  • Metabolic Adaptations: Cells respond to membrane protein overexpression by inducing the acetate-phosphotransacetylase pathway for ATP production and down-regulating the tricarboxylic acid cycle, indicating activation of the Arc two-component system that mediates adaptive responses to changing respiratory states .

These physiological consequences must be considered when designing experiments involving YfbV expression, as they may impact protein yield, functionality, and experimental interpretation.

How can data inconsistencies in studies of proteins like YfbV be identified and addressed?

The analysis of heterogeneous datasets for bacterial proteins like YfbV presents significant challenges for researchers. A systematic approach to identifying and addressing data inconsistencies includes:

What experimental approaches are recommended for studying membrane protein function and interactions of YfbV?

For studying membrane proteins like YfbV, several specialized experimental approaches are recommended:

  • Fusion Protein Techniques: Expression of YfbV fused to reporter proteins such as GFP can facilitate visualization and tracking of the protein within living cells. This approach has been successfully applied to membrane proteins like YidC, YedZ, and LepI and could be adapted for YfbV studies.

  • Proteomics Analysis Pipeline:

    • One-and two-dimensional gel electrophoresis

    • Mass spectrometry

    • Flow cytometry

    • Microscopy

    • Western blotting

    • Pulse labeling experiments

  • Membrane Protein Complex Analysis: Improved two-dimensional blue native PAGE techniques can be employed to analyze the composition and accumulation levels of membrane protein complexes containing YfbV .

  • Site-Specific Chromosome Studies: For examining YfbV's role in chromosome organization, experimental designs involving controlled excision and reinsertion of chromosomal segments can help elucidate its function in relation to the Ter macrodomain .

  • Structural Analysis: While computational models provide a starting point (pLDDT global score: 82.42) , experimental structural determination using techniques appropriate for membrane proteins (X-ray crystallography of properly solubilized protein, cryo-EM, or NMR) would provide more definitive structural information.

How do YfbV proteins from different bacterial species compare?

Comparative analysis of YfbV proteins across different bacterial species reveals both conservation and variation that may provide insights into functional significance:

SpeciesProtein LengthSequence Identity*Key DifferencesStructural Confidence
E. coli O45:K1151 aa100% (reference)N/ANot reported
E. fergusonii151 aa~98%Variations at positions 5, 21, 36, 91, 112Not reported
S. enterica151 aa~95%Not fully detailed in sourcespLDDT: 82.42

*Approximate values based on available sequence data

The high degree of conservation across these species suggests that YfbV plays a fundamental role in bacterial physiology. Particularly notable is the conservation of this protein with MatP through evolution , indicating that YfbV's role in chromosome organization represents an ancient and essential function in bacterial cell division processes.

The subtle sequence variations between species may represent adaptations to specific cellular environments or interaction partners, though detailed structure-function analyses would be required to determine the significance of these differences.

What storage and handling protocols are recommended for recombinant YfbV?

Proper storage and handling of recombinant YfbV is critical for maintaining protein integrity and experimental reproducibility. Based on manufacturer recommendations and standard practices for membrane proteins, the following protocols are advised:

  • Initial Storage:

    • Store lyophilized protein at -20°C upon receipt

    • For extended storage, maintain at -80°C

  • Reconstitution Procedure:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 50% for stability

    • Aliquot for long-term storage at -20°C/-80°C

  • Working Storage:

    • Store working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they significantly decrease protein activity

  • Buffer Conditions:

    • Tris/PBS-based buffer with 6% trehalose, pH 8.0 is recommended for storage

    • For E. fergusonii YfbV, Tris-based buffer with 50% glycerol has been reported

  • Quality Control:

    • Protein purity should be greater than 90% as determined by SDS-PAGE prior to experimental use

How can researchers optimize recombinant YfbV expression to improve yields?

Based on studies of membrane protein expression in E. coli, several strategies can be employed to optimize YfbV expression yields:

  • Expression System Selection:

    • Consider alternative E. coli strains specifically designed for membrane protein expression

    • BL21(DE3) derivatives with modifications to reduce toxic effects of membrane protein overexpression may improve yields

  • Induction Parameters:

    • Lower induction temperatures (16-25°C) often improve membrane protein folding

    • Reduced inducer concentrations and longer expression times may favor proper membrane integration over inclusion body formation

    • Consider auto-induction systems for gradual protein expression

  • Addressing Physiological Responses:

    • Co-expression of chaperones may mitigate aggregation

    • Engineering strains with enhanced membrane protein translocation capacity could reduce cytoplasmic aggregate formation

    • Supplementing growth media with components that support respiratory chain function may counteract the negative impacts of membrane protein overexpression

  • Fusion Partner Selection:

    • N-terminal His-tags have been successfully used for YfbV

    • Other fusion partners (MBP, SUMO) may improve solubility while maintaining membrane association

    • Consider cleavable tags if native protein is required for functional studies

  • Media Formulation:

    • Enriched media formulations that support high cell density while providing precursors for membrane components

    • Carbon source optimization based on the specific metabolic adaptations triggered by membrane protein overexpression, particularly considering the activation of the Arc two-component system

How might understanding YfbV's role in chromosome organization impact broader research in bacterial cell division?

YfbV's identified role in chromosome organization, particularly in restricting the consequences of anchoring the Ter macrodomain to the division machinery , opens several important research avenues:

  • Chromosome Segregation Mechanisms: Further characterization of YfbV could provide insights into how bacteria coordinate chromosome segregation with cell division, a fundamental process in bacterial reproduction.

  • Antimicrobial Target Potential: As a protein involved in essential chromosome organizational processes, YfbV or its interaction partners might represent novel targets for antimicrobial development, particularly if structural or functional differences from eukaryotic proteins can be exploited.

  • Synthetic Biology Applications: Understanding YfbV's role in chromosome constraint could inform the design of synthetic bacterial chromosomes with modified organizational properties, potentially leading to engineered bacteria with novel capabilities.

  • Evolutionary Insights: The conservation of YfbV with MatP through evolution suggests an ancient mechanism for chromosome organization. Comparative studies across bacterial lineages could reveal how chromosome organizational systems evolved and diversified.

What cutting-edge techniques could advance our understanding of YfbV structure and function?

Several advanced methodological approaches could significantly advance our understanding of YfbV:

  • Cryo-Electron Microscopy: While computational models provide a starting point (pLDDT score: 82.42) , high-resolution cryo-EM structures of YfbV in a membrane environment could reveal critical structural details that inform function.

  • Live Cell Super-Resolution Microscopy: Techniques such as PALM, STORM, or lattice light-sheet microscopy could track YfbV dynamics during the cell cycle, potentially revealing spatial and temporal aspects of its function in chromosome organization.

  • ChIP-Seq and Hi-C Approaches: These techniques could map YfbV's interactions with DNA and identify how it contributes to three-dimensional chromosome organization in conjunction with the 12-bp sequences mentioned in the literature .

  • Integrative Multi-Omics Analysis: Combining proteomic, transcriptomic, and metabolomic approaches within a mechanistic modeling framework could address the challenges of data inconsistency identified in bacterial systems research .

  • CRISPR-Based Genome Editing: Precise modification of YfbV and related genes could help dissect their functions in vivo, particularly when combined with high-throughput phenotyping approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.