Recombinant Escherichia fergusonii UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

The yciC protein belongs to the UPF0259 family, a group of hypothetical proteins with conserved membrane-associated domains. In E. fergusonii, it is encoded by the yciC gene (UniProt ID: B7LS23) and functions as a partial or full-length membrane protein . While its exact biological role remains unclear, its localization in bacterial membranes suggests potential involvement in transport, signaling, or structural stability .

Expression Systems and Tags

The recombinant yciC protein is produced in multiple hosts, including E. coli, yeast, and mammalian cells, with varying tags for purification and functional studies :

HostTagPuritySource
E. coliHis-tag, AviTag>85% (SDS-PAGE)
YeastN/AN/A
Mammalian cellsN/AN/A

Key Features:

  • Partial vs. Full-Length: E. fergusonii yciC is often expressed as a partial protein (aa 1–247) , while Salmonella Newport yciC is produced as a full-length version (1–247aa) .

  • Biotinylation: In E. coli, AviTag technology enables site-specific biotinylation for ligand-receptor binding studies .

Functional Domains

  • Transmembrane Regions: Predicted by hydrophobicity analysis .

  • Solubility: Enhanced by tags (e.g., His-tag) in E. coli .

Vaccine Development

While not directly linked to yciC, UPF0259 proteins are prioritized in E. fergusonii vaccine studies due to their surface exposure and virulence potential . Recombinant yciC could serve as a candidate for epitope mapping or antigenicity assays.

Membrane Protein Studies

  • Structural Analysis: Used to study bacterial membrane topology and protein-lipid interactions .

  • Endotoxin Reduction: Co-expression with YciM (a regulatory protein) in E. coli reduces endotoxin contamination in recombinant proteins .

Challenges and Considerations

  • Endotoxin Contamination: E. coli-derived yciC may require specialized strains (e.g., LPS-deficient) to minimize contaminants .

  • Host-Specific Modifications: Post-translational modifications (e.g., glycosylation) differ between hosts, impacting functional studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciC; EFER_1699; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
yciC
Target Protein Sequence
MSITAQSVYRDTGNFFRNQFMTILLVSLLCAFITVVIGHVFSPSEAQLASLDKVETLSDN AGLFEIVQNMSLEQKQVLVQASAASTFSGLIGNAILAGGMLLLIQLVSAGHRVSALRAIG ASAPILPKLFILIFLTTLMVQIGIMFVVVPGILMAIVLALAPVMLVQDKMGVFASMRSSI RLTWANMRLIAPAVLSWLLAKTALLLLASRFAALTPEVGAILANTLSNLFSAVLLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the E. fergusonii yciC protein differ from its E. coli homolog?

The UPF0259 membrane protein yciC shows high sequence similarity between E. fergusonii and E. coli, reflecting their close evolutionary relationship. Sequence alignment reveals specific differences:

FeatureE. fergusonii yciCE. coli yciC
UniProt IDB7LS23Q1RCH9 (UTI89 strain)/B1ITK0 (ATCC 8739)
Amino acid length247 amino acids247 amino acids
Key sequence differencesVIGHVFSPSEAQLASLDKVETLSDNVLGHVFSPSDAQLAQLNDGVPVSGS
Transmembrane topologySimilar pattern with minor variationsSimilar pattern with minor variations

What are the optimal conditions for expressing and purifying recombinant E. fergusonii yciC protein?

Successful expression and purification of recombinant E. fergusonii yciC protein requires careful optimization of multiple parameters:

Expression System Selection:

  • E. coli-based expression systems are commonly used due to their efficiency for bacterial membrane proteins

  • Consider specialized strains designed for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3))

Expression Optimization:

  • Induce expression at lower temperatures (16-25°C) to facilitate proper folding

  • Use lower inducer concentrations to prevent formation of inclusion bodies

  • Consider co-expression with chaperones to improve folding efficiency

Purification Strategy:

  • Cell lysis: Use gentle detergent-based methods to solubilize membrane proteins

  • Initial purification: Immobilized metal affinity chromatography (IMAC)

  • Secondary purification: Size exclusion chromatography for higher purity

Buffer Optimization:

  • Include appropriate detergents (DDM, LDAO, or Fos-choline) to maintain protein solubility

  • Add glycerol (10-20%) to enhance stability

  • Maintain pH between 7.0-8.0

The accessibility of translation initiation sites has been shown to significantly impact recombinant protein expression success. Analysis of the mRNA secondary structure around the start codon, particularly the base-unpairing across the Boltzmann's ensemble, can predict expression efficiency . Tools like TIsigner can be used to optimize the first nine codons through synonymous substitutions to enhance expression levels.

What methods are most effective for studying the membrane topology and structure of yciC protein?

Several complementary methods can elucidate the membrane topology and structure of yciC:

Computational Prediction Methods:

  • Transmembrane prediction algorithms (TMHMM, Phobius)

  • Evolutionary co-variation analysis to identify structurally important residues

  • Molecular dynamics simulations to model membrane integration

Experimental Approaches:

  • Cysteine scanning mutagenesis: Systematically introducing cysteine residues and assessing their accessibility to membrane-impermeable reagents

  • Protease protection assays: Determining exposed regions by limited proteolysis

  • FRET-based approaches: Measuring distances between domains using fluorescently labeled variants

Advanced Structural Biology Techniques:

  • Cryo-electron microscopy for membrane proteins in nanodiscs or detergent micelles

  • X-ray crystallography (challenging but potentially informative)

  • NMR spectroscopy for specific domains or the full-length protein

A comprehensive analysis would combine evolutionary co-variation analysis with molecular dynamics simulations and experimental validation through site-directed mutagenesis, similar to approaches used for YidC protein characterization . This multi-tiered approach allows for reliable topology mapping and identifies functionally important regions.

How can researchers effectively assess the functional role of yciC in bacterial membranes?

To determine the functional role of yciC in bacterial membranes, researchers should employ a multi-faceted approach:

Genetic Approaches:

  • Gene knockout studies: Generate clean deletion mutants of yciC and assess phenotypic changes

  • Complementation experiments: Reintroduce wild-type or mutant versions to confirm phenotype rescue

  • Conditional expression systems: Use inducible promoters to control expression levels

Biochemical Characterization:

  • Protein-protein interaction studies: Co-immunoprecipitation, bacterial two-hybrid systems, or crosslinking approaches to identify interaction partners

  • Transport assays: If involved in transport, measure substrate flux in reconstituted proteoliposomes

  • Metal binding assays: Test binding of various metal ions (particularly zinc) given the potential role in metal transport pathways

Phenotypic Analysis:

  • Growth curve analysis under various stress conditions

  • Membrane integrity assays

  • Resistance profiles to antibiotics targeting membrane functions

Based on findings in related systems, examining growth under zinc limitation would be particularly informative, as mutational studies in Bacillus subtilis showed that yciC mutation impacts growth under zinc limitation conditions . Additionally, coupling these approaches with transcriptomic analysis can reveal broader regulatory networks involving yciC.

What are the most reliable methods to differentiate between E. fergusonii and E. coli when working with yciC proteins?

Differentiating between E. fergusonii and E. coli yciC proteins requires precise molecular methods:

Genetic Differentiation Methods:

  • 16S rRNA sequencing: While commonly used for bacterial identification, this method alone is insufficient for distinguishing between these closely related species

  • Adenylate kinase (adk) gene analysis: Phylogenetic analysis using the adk gene from the E. coli multi-locus sequence typing (MLST) scheme provides reliable differentiation

  • Whole genome sequencing: For definitive species identification when resources permit

Protein-Specific Differentiation:

  • Mass spectrometry: Peptide mass fingerprinting can detect species-specific variations

  • Antibody-based methods: Development of antibodies targeting divergent epitopes between the species

  • High-resolution melt curve analysis: Can distinguish between closely related sequence variants

Research has identified four specific loci in the adk gene sequences that reliably discriminate between E. coli and E. fergusonii . When analyzing proteins from clinical or environmental samples, these molecular markers should be used to ensure accurate species assignment.

How can E. fergusonii yciC protein be utilized in multi-epitope vaccine development?

The UPF0259 membrane protein yciC has potential applications in multi-epitope vaccine (MEV) development against E. fergusonii infections:

Epitope Identification Process:

  • Retrieve complete proteome of all known E. fergusonii strains

  • Filter for surface-exposed virulent proteins (including membrane proteins like yciC)

  • Process identified proteins for B-cell and T-cell epitope mapping

  • Evaluate epitopes for antigenicity, allergenicity, solubility, MHC-binding, and toxicity

  • Fuse filtered epitopes using specific linkers and adjuvants into a vaccine construct

Structural Analysis and Validation:

  • Predict and refine the structure of the vaccine candidate

  • Evaluate structural stability using metrics like VERIFY3D score

  • Perform molecular docking with immune receptors (TLR-4, MHC-I, MHC-II)

  • Conduct molecular dynamic simulations to assess stability of docked complexes

This immunoinformatics approach has shown promise for E. fergusonii, with computational vaccine candidates demonstrating favorable immune response predictions. Key membrane proteins like yciC can contribute important epitopes due to their surface exposure and conservation across strains .

What advanced analytical techniques can elucidate potential interactions between yciC and other membrane proteins?

Understanding the interaction network of yciC requires sophisticated analytical approaches:

Proximity-Based Interaction Mapping:

  • BioID or APEX2 proximity labeling: Fusing biotin ligase to yciC to identify nearby proteins in the native membrane environment

  • Cross-linking mass spectrometry (XL-MS): Using membrane-permeable crosslinkers followed by mass spectrometry

  • FRET-based interaction screening: For testing specific protein pairs in reconstituted systems

Functional Interaction Mapping:

  • Genetic interaction screens: Systematic double-mutant analysis to identify synthetic phenotypes

  • Suppressor screens: Identifying mutations that rescue yciC mutant phenotypes

  • Reconstitution studies: Rebuilding minimal systems with purified components

Structural Approaches for Complexes:

  • Cryo-electron microscopy: For visualizing intact membrane protein complexes

  • Native mass spectrometry: For determining complex stoichiometry and stability

  • Integrated structural biology: Combining multiple methods (crosslinking, mass spectrometry, EM) for model building

Research on related membrane proteins suggests that yciC may function as part of multi-protein complexes involved in transport or signaling pathways . Approaches successfully used to characterize the YidC complex in E. coli, such as evolutionary co-variation analysis coupled with cryo-electron microscopy, could be applied to understand yciC interactions .

What are the best experimental designs for studying yciC function in different bacterial strains?

Robust experimental design is critical for elucidating yciC function across strains:

Comparative Study Design Framework:

Design ElementRecommendationRationale
Strain selectionInclude reference strains and clinical isolatesCaptures functional variation across evolutionary space
Control conditionsBoth positive (known function) and negative (deletion) controlsEstablishes baseline and maximum effect sizes
Replication strategyMinimum 3 biological replicates, each with 3 technical replicatesAccounts for biological and technical variance
Factorial designTest multiple factors (nutrient conditions, stress, etc.)Identifies condition-specific functions
Time-course analysisMultiple sampling pointsCaptures dynamic responses and adaptation

Statistical Analysis Approaches:

  • Use appropriate statistical tests based on data distribution (parametric vs. non-parametric)

  • Consider mixed-effects models for nested experimental designs

  • Apply correction for multiple hypothesis testing when screening many conditions

Addressing Research Questions:

  • For functional characterization: Consider gene complementation experiments with wild-type and mutant versions

  • For comparative analysis: Implement side-by-side testing under identical conditions

  • For systems-level understanding: Integrate with global approaches (transcriptomics, proteomics)

When designing experiments involving multiple bacterial strains, researchers should carefully consider strain selection to represent both phylogenetic diversity and functional relevance to the research question . Quantitative data analysis should employ appropriate statistical methods, with descriptive statistics summarizing distribution, central tendency, and variability of the data .

How should researchers approach data contradictions in yciC functional studies?

Researchers frequently encounter conflicting data when studying membrane proteins like yciC. A systematic approach to resolving contradictions includes:

Contradiction Identification and Analysis:

  • Catalog specific contradictions with exact experimental conditions

  • Evaluate methodological differences that might explain discrepancies

  • Assess strain differences and genetic backgrounds used

  • Consider environmental variables and growth conditions

Resolution Strategies:

  • Direct replication: Reproduce both contradicting results following original protocols exactly

  • Parameter isolation: Systematically vary one parameter at a time to identify critical variables

  • Method triangulation: Apply multiple orthogonal methods to address the same question

  • Meta-analysis: Formally analyze all available data to identify patterns explaining contradictions

Reporting Framework:

  • Transparently document all contradictions

  • Present multiple working hypotheses that could explain discrepancies

  • Design critical experiments specifically to distinguish between competing hypotheses

  • Consider biological context and evolutionary variations

As seen in research on related membrane proteins, contradictions often arise from subtle differences in experimental conditions or strain-specific variations . When studying yciC function, researchers should be particularly attentive to zinc concentration in growth media, as this has been shown to influence the phenotypic effects of mutations in related systems .

What biosafety requirements apply to research with recombinant E. fergusonii yciC protein?

Research involving recombinant E. fergusonii proteins requires appropriate biosafety measures:

Regulatory Oversight:

  • Research involving recombinant DNA technology typically requires Institutional Biosafety Committee (IBC) review and approval

  • Work with potentially infectious bacterial proteins must follow institutional, national, and international biosafety guidelines

Biosafety Level Recommendations:

  • E. fergusonii work generally requires BSL-2 facilities and practices

  • Recombinant protein work may be conducted at BSL-1 if purified proteins pose minimal risk

Protocol Requirements:

  • Standard operating procedures for handling recombinant proteins

  • Appropriate waste disposal protocols

  • Spill management procedures

  • Personal protective equipment guidelines

  • Training requirements for all personnel

Documentation:

  • Maintain detailed records of all experiments

  • Document risk assessments

  • Keep biosafety approval documentation current

Researchers must consult with their institutional biosafety officers and committees before beginning work with recombinant E. fergusonii proteins to ensure compliance with all applicable regulations .

How can researchers optimize storage conditions for maintaining the stability of purified recombinant yciC protein?

Maintaining stability of purified recombinant yciC protein requires optimized storage conditions:

Short-term Storage (1-7 days):

  • Store working aliquots at 4°C

  • Use buffer containing 50% glycerol to enhance stability

  • Include protease inhibitors to prevent degradation

Long-term Storage (>7 days):

  • Store at -20°C for routine storage

  • For extended preservation, store at -80°C

  • Avoid repeated freeze-thaw cycles, which can compromise protein integrity

Buffer Optimization for Storage:

  • Tris-based buffer systems (pH 7.5-8.0) provide good stability

  • Include 50% glycerol as a cryoprotectant

  • Add reducing agents (DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

  • Consider adding specific detergents to maintain membrane protein solubility

Quality Control Measures:

  • Periodically test protein activity to ensure functional integrity

  • Monitor for degradation using SDS-PAGE

  • Validate protein structure using circular dichroism or other spectroscopic methods

  • Document batch variability and storage duration effects

Proper aliquoting of purified protein minimizes freeze-thaw cycles and maintains protein integrity for longer periods. For membrane proteins like yciC, maintaining the appropriate detergent concentration above its critical micelle concentration is essential for preventing aggregation during storage .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.