Recombinant Escherichia fergusonii UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycjF; EFER_1652; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
ycjF
Target Protein Sequence
MTEPLKPRIDFDGPLEVDQSPKFKAQQTFDENQAQNFAPATLDEAPEEEGQVEAVMDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARDLLHSHGAGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVTLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWLDDDKPRLGDFRRQLIGQLKETLQKAPTRREN
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0283 membrane protein ycjF in Escherichia fergusonii?

UPF0283 membrane protein ycjF in E. fergusonii is a membrane-associated protein belonging to the uncharacterized protein family UPF0283. Based on homology with E. coli ycjF, it likely consists of approximately 353 amino acids. The designation "UPF" indicates that its precise function remains to be fully elucidated. In the closely related E. coli, ycjF is associated with the cell membrane and may play roles in membrane integrity, transport processes, or stress responses . E. fergusonii shares many genomic features with E. coli but has distinct pathogenicity profiles and ecological niches, which may be reflected in subtle functional differences in the ycjF protein .

How is recombinant E. fergusonii ycjF protein typically expressed and purified?

Based on established protocols for similar membrane proteins including E. coli ycjF, the methodological approach typically involves:

  • Expression vector design: Cloning the ycjF gene into a suitable expression vector with an N-terminal or C-terminal affinity tag (commonly His-tag)

  • Expression system selection: Using E. coli as the expression host (commonly BL21(DE3) or derivatives)

  • Culture conditions: Growing in LB or other rich media at 37°C until reaching appropriate density

  • Induction: Using IPTG or other inducers at optimized concentration (typically 0.1-1.0 mM), often at reduced temperature (16-30°C) to enhance proper folding

  • Cell harvesting and lysis: Centrifugation followed by mechanical, chemical, or enzymatic disruption

  • Membrane protein extraction: Solubilization using appropriate detergents

  • Affinity purification: Using Ni-NTA or similar matrix for His-tagged proteins

  • Additional purification: Size exclusion chromatography or ion exchange chromatography if higher purity is required

  • Verification: SDS-PAGE, Western blotting, and mass spectrometry to confirm identity and purity

What storage conditions are optimal for maintaining stability of recombinant ycjF protein?

Optimal storage conditions for recombinant ycjF protein would include:

  • Short-term storage: 4°C for up to one week

  • Long-term storage: -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles

  • Storage buffer: Tris/PBS-based buffer with approximately 6% Trehalose at pH 8.0

  • Lyophilization: Often used for long-term stability

  • Reconstitution: Using deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Glycerol addition: 5-50% (typically 50%) for cryoprotection during freezing

  • Working aliquots: Preparation of smaller volumes to minimize freeze-thaw cycles

These conditions are based on recommendations for similar recombinant membrane proteins and should be optimized experimentally for the specific preparation .

Why is E. fergusonii gaining interest as a research subject?

E. fergusonii is receiving increased attention because:

  • Emerging pathogen status: It is considered an opportunistic pathogen with zoonotic potential, causing infections ranging from wound infections to hemolytic uremic syndrome

  • Antimicrobial resistance: Increasing reports of multidrug resistance, including extended-spectrum beta-lactamases (ESBLs), carbapenemases, and mobilized colistin resistance (mcr) genes

  • Virulence potential: Presence of virulence factors such as heat-labile toxin (LT), heat-stable toxin (STa), and eae gene

  • Environmental persistence: Ability to form biofilms, contributing to persistence and treatment resistance

  • Genomic diversity: Greater genomic diversity in avian strains compared to other sources, with potential implications for pathogenicity and resistance spread

These characteristics make E. fergusonii and its proteins, including membrane proteins like ycjF, important subjects for understanding the organism's biology, pathogenicity mechanisms, and potential therapeutic targets4 .

How do the structural and functional characteristics of ycjF proteins vary across Escherichia species?

The structural and functional characteristics of ycjF proteins across Escherichia species require sophisticated comparative analysis:

  • Sequence alignment reveals high conservation within the UPF0283 family, with E. fergusonii ycjF showing closest homology to E. coli variants

  • Predicted membrane topology includes multiple transmembrane domains, with conserved residues clustering in potential functional sites

  • Phylogenetic analysis demonstrates that ycjF proteins cluster according to isolation source and geographical location, suggesting potential adaptive evolution

  • Functional differences may correlate with host specificity, with avian strains showing distinct characteristics from mammalian isolates

  • Expression levels vary under different stress conditions, potentially reflecting niche-specific adaptations

  • Association with mobile genetic elements differs between species, with avian E. fergusonii strains harboring significantly higher numbers of mobile genetic elements compared to other sources

This variation may reflect adaptation to different hosts and environmental conditions, potentially contributing to differences in pathogenicity and antibiotic resistance profiles between species .

What methodological approaches can determine the role of ycjF in antimicrobial resistance?

To investigate the potential role of ycjF in antimicrobial resistance, researchers should employ:

  • Gene knockout/knockdown studies:

    • CRISPR-Cas9 targeting early constitutive exons

    • Antisense RNA strategies

    • Measuring MIC changes for multiple antibiotics

  • Transcriptomic analysis:

    • RNA-seq under antibiotic pressure

    • qRT-PCR validation of expression changes

    • Correlation with resistance phenotypes

  • Protein interaction studies:

    • Pull-down assays with known resistance determinants

    • Bacterial two-hybrid systems

    • Cross-linking mass spectrometry

  • Membrane permeability assays:

    • Fluorescent dye uptake measurements

    • Liposome reconstitution experiments

    • Electrophysiology for potential channel activity

  • Comparative genomics:

    • Correlation between ycjF variants and resistance profiles

    • Analysis of genomic context near resistance determinants

    • Presence of regulatory elements affecting both ycjF and resistance genes

How does post-translational modification affect ycjF function in different cellular contexts?

Post-translational modifications (PTMs) may significantly impact ycjF function through:

  • Identification methods:

    • LC-MS/MS after enrichment for specific modifications

    • Western blotting with modification-specific antibodies

    • Phosphoproteomic analysis under various conditions

  • Functional consequences:

    • Site-directed mutagenesis of modified residues

    • Activity assays comparing modified and unmodified forms

    • Localization studies to determine if PTMs affect membrane insertion

  • Regulatory mechanisms:

    • Identification of kinases, phosphatases, or other modifying enzymes

    • Temporal analysis of modification patterns during stress response

    • Correlation between modification status and protein-protein interactions

  • Species-specific differences:

    • Comparative analysis of modification sites across Escherichia species

    • Correlation with pathogenicity or resistance phenotypes

    • Evolutionary conservation analysis of modification sites

These approaches can reveal how PTMs might regulate ycjF activity in response to environmental signals, potentially contributing to adaptability and stress response .

What is the relationship between ycjF expression and virulence in different E. fergusonii strains?

The relationship between ycjF expression and virulence requires multi-faceted investigation:

  • Expression correlation:

    • Transcriptomic comparison between highly virulent and avirulent strains

    • Gene expression analysis during host infection models

    • Correlation with expression of known virulence factors

  • Genetic manipulation:

    • Virulence assessment in ycjF knockout/overexpression strains

    • Complementation studies with ycjF variants from strains with different virulence profiles

    • Host infection models comparing wild-type and modified strains

  • Host-pathogen interaction:

    • Adhesion and invasion assays with epithelial cell lines

    • Macrophage survival and replication studies

    • Animal infection models measuring colonization and disease progression

  • Source-specific patterns:

    • Comparison between isolates from different hosts (avian, bovine, porcine, human)

    • Correlation with pathogenic potential based on isolation source

    • Analysis of adaptive mutations in different host environments

Research has shown that bovine strains of E. fergusonii have significantly higher pathogenic potential compared to strains from other sources, suggesting host-specific virulence adaptations that may involve membrane proteins like ycjF .

What factors should be optimized when designing CRISPR-Cas9 experiments for ycjF functional studies?

Optimal CRISPR-Cas9 experimental design for ycjF functional studies requires:

  • Guide RNA design:

    • Target early constitutive exons for complete disruption

    • Design multiple gRNAs (at least three) for each target

    • Use bioinformatic tools like TrueDesign Genome Editor for off-target prediction

    • Verify PAM site accessibility in the genomic context

  • Delivery optimization:

    • Determine optimal transformation protocol for E. fergusonii

    • Consider plasmid-based vs. ribonucleoprotein delivery

    • Optimize selection markers for your specific strain

  • Editing strategy:

    • For knockout: target sites creating frameshift mutations

    • For knock-in: ensure cleavage site is within 10 bp of the edit site

    • For precise modifications: design appropriate homology arms

  • Verification approaches:

    • PCR and sequencing confirmation of edits

    • Expression analysis at RNA and protein levels

    • Phenotypic characterization with appropriate controls

  • Cas nuclease selection:

    • Consider SpCas9 for standard experiments

    • Evaluate alternative Cas variants for specific applications (e.g., base editing)

    • Assess temperature sensitivity for your experimental conditions

How should researchers design control experiments for ycjF functional studies?

Robust control experiments for ycjF functional studies must include:

  • Genetic controls:

    • Wild-type parental strain maintained under identical conditions

    • Empty vector controls for plasmid-based experiments

    • Complementation with wild-type ycjF to confirm phenotype specificity

    • Synonymous mutation controls to distinguish nucleotide from protein effects

  • Experimental controls:

    • Technical replicates to assess methodological variation

    • Biological replicates (≥3) from independent transformations/cultures

    • Time course measurements to distinguish primary from secondary effects

    • Multiple growth conditions to identify context-dependent phenotypes

  • Validation approaches:

    • Multiple methodologies to confirm key findings

    • Dose-response relationships for overexpression studies

    • Heterologous expression to test function in different backgrounds

    • Sequential deletion/complementation to confirm causality

  • Statistical considerations:

    • Power analysis to determine appropriate sample sizes

    • Appropriate statistical tests for data type and distribution

    • Multiple testing correction for high-throughput analyses

    • Blinding procedures for subjective assessments

These controls help distinguish direct effects of ycjF manipulation from experimental artifacts or indirect consequences .

What methods are most effective for studying membrane protein interactions involving ycjF?

Membrane protein interaction studies for ycjF require specialized approaches:

  • In vivo techniques:

    • Bacterial two-hybrid systems optimized for membrane proteins

    • Split-GFP complementation assays

    • FRET/BRET analysis with fluorescent protein fusions

    • Proximity labeling (BioID, APEX2) to identify the interactome

  • Biochemical methods:

    • Co-immunoprecipitation with gentle detergent solubilization

    • Cross-linking followed by mass spectrometry (XL-MS)

    • Blue native PAGE to preserve native complexes

    • Surface plasmon resonance for purified components

  • Structural approaches:

    • Cryo-electron microscopy of membrane complexes

    • X-ray crystallography of co-purified complexes

    • NMR for dynamic interaction studies

    • Computational docking validated by mutagenesis

  • Functional validation:

    • Genetic epistasis analysis with potential interaction partners

    • Co-expression studies measuring functional consequences

    • Competition assays with peptide mimics of interaction interfaces

    • Reconstitution in liposomes or nanodiscs

These complementary approaches can overcome the challenges inherent in studying membrane protein interactions .

How can researchers effectively compare ycjF function across different E. fergusonii isolates?

Comparative analysis of ycjF function across E. fergusonii isolates requires:

  • Strain selection strategy:

    • Include isolates from diverse sources (avian, bovine, porcine, human, environmental)

    • Represent different geographical locations

    • Include strains with varying antimicrobial resistance profiles

    • Select strains with diverse pathogenicity characteristics

  • Comparative genomics:

    • Whole-genome sequencing and assembly

    • SNP and structural variant calling

    • ycjF sequence alignment and phylogenetic analysis

    • Genomic context analysis for ycjF

  • Functional characterization:

    • Expression level comparison by qRT-PCR

    • Protein localization studies using fluorescent tags

    • Phenotypic assays under standardized conditions

    • Cross-complementation studies in knockout backgrounds

  • Data integration:

    • Correlation analysis between sequence variation and phenotypes

    • Pan-genome analysis to identify co-evolving genes

    • Network analysis incorporating protein interaction data

    • Evolutionary analysis to identify selection pressures

Research has demonstrated significant differences between E. fergusonii strains from different sources, with avian strains showing greater genomic diversity and higher numbers of antimicrobial resistance genes .

How should researchers interpret conflicting results from in vitro and in vivo ycjF studies?

When faced with conflicting results between in vitro and in vivo studies of ycjF:

  • Methodological reconciliation:

    • Evaluate differences in experimental conditions (pH, temperature, ionic strength)

    • Consider concentration effects and whether in vitro conditions reflect physiological context

    • Assess if expression systems introduce artifacts (tags, fusion partners)

    • Examine differences in protein folding and modification between systems

  • Biological context analysis:

    • Identify potential interaction partners present in vivo but absent in vitro

    • Consider membrane composition differences affecting protein function

    • Evaluate regulatory factors present in cellular context

    • Assess metabolic state influences on protein activity

  • Validation strategies:

    • Design new experiments specifically addressing discrepancies

    • Use orthogonal methods to verify key findings

    • Develop intermediate complexity models (e.g., ex vivo systems)

    • Create defined reconstitution systems adding complexity incrementally

  • Interpretation framework:

    • Consider if differences reveal context-dependent functions

    • Evaluate if results represent different aspects of a complex function

    • Assess temporal factors that might explain apparent contradictions

    • Develop integrated models accommodating seemingly contradictory results

This systematic approach helps resolve apparent contradictions and may reveal important contextual factors affecting ycjF function4 .

What bioinformatic approaches are most valuable for analyzing ycjF across Escherichia species?

Comprehensive bioinformatic analysis of ycjF requires:

  • Sequence-based analyses:

    • Multiple sequence alignment using MUSCLE or Clustal Omega

    • Phylogenetic tree construction with maximum likelihood or Bayesian methods

    • Calculation of selection metrics (dN/dS) to identify evolutionary pressures

    • Identification of conserved domains and functional motifs

  • Structural predictions:

    • Transmembrane domain prediction using TMHMM or Phobius

    • Secondary structure prediction with PSIPRED

    • Homology modeling using Swiss-Model or I-TASSER

    • Molecular dynamics simulations to assess stability and conformational changes

  • Genomic context analysis:

    • Operon structure and gene neighborhood conservation

    • Regulatory element identification and comparison

    • Mobile genetic element association

    • Synteny analysis across species

  • Functional inference:

    • Gene ontology enrichment of co-expressed genes

    • Protein-protein interaction network analysis

    • Pathway and functional domain enrichment

    • Literature-based association analysis

These approaches allow researchers to generate testable hypotheses about ycjF function based on evolutionary and structural features .

How can variability in experimental results with ycjF proteins be managed and interpreted?

Managing variability in ycjF experimental results requires:

  • Source identification:

    • Distinguish biological from technical variability

    • Identify strain-specific factors affecting results

    • Evaluate environmental variables influencing protein function

    • Consider batch effects in protein preparation

  • Standardization procedures:

    • Develop detailed standard operating procedures

    • Implement quality control metrics for protein preparations

    • Use internal controls for normalization

    • Standardize growth conditions and media composition

  • Statistical approaches:

    • Apply appropriate statistical tests based on data distribution

    • Use mixed-effects models to account for nested variables

    • Implement meta-analysis techniques for cross-study comparison

    • Consider Bayesian approaches for integrating prior knowledge

  • Reporting standards:

    • Detailed methodology documentation

    • Complete data sharing, including raw data

    • Transparent disclosure of failed or inconsistent experiments

    • Standardized nomenclature and measurement units

Research on E. fergusonii has shown significant strain-to-strain variability, particularly between isolates from different sources, highlighting the importance of rigorous approaches to managing experimental variability .

What criteria should be used to evaluate the physiological relevance of in vitro findings about ycjF?

Evaluating physiological relevance of in vitro ycjF findings requires:

  • Concentration considerations:

    • Compare protein concentrations to physiological levels

    • Assess dose-response relationships across physiological range

    • Consider compartmentalization effects in cellular contexts

  • Environmental parameters:

    • Match pH, ionic strength, and temperature to physiological conditions

    • Include relevant cofactors and binding partners

    • Consider membrane composition effects on protein function

    • Assess oxygen tension and redox conditions

  • Validation approaches:

    • Correlate in vitro findings with in vivo phenotypes

    • Develop genetic tools to test predictions in living cells

    • Use site-directed mutagenesis to confirm mechanistic insights

    • Develop biosensors to monitor activity in living cells

  • Translational context:

    • Assess conservation of findings across relevant strains

    • Evaluate environmental conditions mimicking infection sites

    • Consider host factors potentially influencing activity

    • Test predictions in infection models when appropriate

This systematic evaluation helps determine which in vitro findings are likely to represent true physiological functions versus experimental artifacts4 .

Comparative Analysis of E. fergusonii ycjF Characteristics

CharacteristicE. fergusonii ycjFE. coli ycjFSignificance for Research
Protein Length~353 amino acids (predicted)353 amino acidsConservation suggests functional importance
Amino Acid SequenceSpecies-specific variations in key regionsReference sequence (P0A8R7)Variations may correlate with pathogenicity differences
Membrane AssociationConfirmed membrane proteinUPF0283 membrane proteinImportant for experimental design and purification strategies
Expression SystemsE. coli expression systems with optimizationNative and recombinant systemsAffects protein folding and post-translational modifications
Storage StabilityRequires glycerol and low temperatureStable in Tris/PBS buffer with 6% trehaloseCritical for maintaining activity during experimental work
Antimicrobial Resistance AssociationHigher in avian strainsVariableMay indicate role in strain-specific resistance mechanisms
Mobile Genetic Element AssociationSignificantly higher in avian and porcine strainsLess associatedSuggests potential for horizontal transfer and evolution
Pathogenic PotentialHighest in bovine strainsVariableIndicates possible host adaptation mechanisms
Genomic DiversityHigher in avian strainsMore conservedImportant for understanding evolutionary pressures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.