Recombinant Escherichia fergusonii Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
zntB; EFER_1629; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Target Names
zntB
Target Protein Sequence
MEAIKGADVNVPDAVFAWILDRNGGVKPLTDNDVIDSEHPCWLHLNYTHPESAQWLATTP LLPNNVRDALAGESTRPRVNRMGEGTLITLRCINGSTDERPDQLVAMRVYMDERLIVSTR QRKVLALDDVVSDLEEGTGPEDCGGWLVDVCDALTDHASEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLSSERLPWMNDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWR FGFSLFCILLVVLIGGVALWLHRSKWL
Uniprot No.

Target Background

Function
Mediates the efflux of zinc ions.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does ZntB differ from other zinc transport systems in Escherichia species?

Zinc homeostasis in Escherichia species involves multiple transport systems with distinct roles:

Transport SystemDirectionTypeAffinityPrimary Function
ZntBEffluxCorA-familyModerateZinc export during excess
ZnuACBInfluxABC transporterHighPrimary zinc uptake in zinc-limited conditions
ZupTInfluxZIP familyLowerSecondary zinc uptake; also transports Mn²⁺ and Fe²⁺
SitABCDInfluxABC transporterLow for ZnPrimary Mn²⁺/Fe²⁺ transport; marginal Zn²⁺ binding

ZntB is specifically involved in zinc efflux, unlike ZnuACB and ZupT which primarily function as zinc uptake systems. Experimental evidence from transport assays shows that ZntB mutations lead to increased intracellular zinc accumulation, consistent with its role in zinc export. Notably, while ZnuACB is zinc-specific, ZntB may also mediate the efflux of cadmium, as mutations in ZntB confer increased sensitivity to both zinc and cadmium .

What are the optimal conditions for recombinant expression of E. fergusonii ZntB protein?

For optimal recombinant expression of E. fergusonii ZntB, researchers should consider the following methodological approach:

Expression System Selection:

  • E. coli BL21(DE3) strains are commonly used for ZntB expression due to their reduced protease activity

  • For membrane proteins like ZntB, C41(DE3) or C43(DE3) strains may provide better yields by accommodating membrane protein overexpression

Vector and Tag Considerations:

  • pET vector systems with T7 promoters show efficient expression

  • When using tags, consider that N-terminal tags are preferable as C-terminal modifications may interfere with membrane insertion

  • His6-tags facilitate purification while MBP or SUMO tags can improve solubility

Expression Conditions:

  • Induce with 0.1-0.5 mM IPTG at OD600 of 0.6-0.8

  • Reduce temperature to 16-20°C post-induction to minimize inclusion body formation

  • Extended expression time (16-18 hours) at lower temperatures improves proper membrane insertion

Media and Supplements:

  • LB medium supplemented with 0.2-0.5 mM ZnSO₄ can improve expression

  • For labeled protein production (e.g., for structural studies), minimal media with controlled zinc concentrations are recommended

It's important to note that transcription of recombinant genes can significantly impact host cell growth more than the actual protein translation process. Studies have shown that high levels of recombinant mRNA production can cause growth inhibition independent of protein synthesis .

What purification strategy yields the highest purity and activity for recombinant ZntB protein?

A multi-step purification strategy is recommended for obtaining high-purity, functionally active recombinant ZntB:

Step 1: Membrane Fraction Isolation

  • Harvest cells and disrupt by sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Separate membrane fraction by ultracentrifugation (100,000×g for 1 hour)

  • Solubilize membranes with 1% n-dodecyl-β-D-maltoside (DDM) or 1% n-decyl-β-D-maltoside (DM)

Step 2: Affinity Chromatography

  • For His-tagged ZntB, use Ni-NTA resin equilibrated with solubilization buffer containing 0.05% detergent

  • Wash with 20-40 mM imidazole to remove non-specific binding

  • Elute with 250-300 mM imidazole gradient

Step 3: Size Exclusion Chromatography

  • Apply concentrated protein to Superdex 200 column equilibrated with 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, and 0.03% DDM

  • Collect fractions corresponding to the proper oligomeric state (primarily pentameric for ZntB)

Quality Control Metrics:

  • Purity >95% as assessed by SDS-PAGE

  • A₂₈₀/A₂₆₀ ratio >1.8 indicating minimal nucleic acid contamination

  • Zinc transport activity measured in proteoliposomes using ⁶⁵Zn²⁺ efflux assays

For storage, add 50% glycerol and store at -20°C or flash-freeze in liquid nitrogen for storage at -80°C. Avoid repeated freeze-thaw cycles and store working aliquots at 4°C for up to one week to maintain activity .

How can researchers accurately measure zinc transport activity of recombinant ZntB?

Accurate measurement of ZntB zinc transport activity requires specialized techniques that can distinguish between uptake and efflux processes:

⁶⁵Zn²⁺ Efflux Assays:

  • Preloading Cells/Vesicles: Incubate bacterial cells or reconstituted proteoliposomes with ⁶⁵Zn²⁺ to allow internal accumulation

  • Initiating Efflux: Remove external ⁶⁵Zn²⁺ by washing, then resuspend in zinc-free buffer

  • Measuring Efflux Rate: Take samples at timed intervals and measure remaining intracellular ⁶⁵Zn²⁺

  • Analysis: Calculate efflux rate as the decrease in intracellular ⁶⁵Zn²⁺ over time

In comparative studies between wild-type and ZntB mutant strains, researchers observed that ZntB mutations resulted in 1.2-fold greater ⁶⁵Zn²⁺ accumulation compared to wild-type controls, confirming ZntB's role in zinc efflux rather than uptake. Expression of ZntB from a complementing plasmid restored normal zinc levels, reducing accumulation to 1.1-fold of wild-type levels .

Fluorescent Probe-Based Assays:

  • Alternative approach using zinc-sensitive fluorescent probes (e.g., FluoZin-3)

  • Measure real-time changes in intracellular zinc concentration

  • Particularly useful for examining kinetics of transport

Control Experiments Required:

  • Use ionophores (e.g., pyrithione) as positive controls for membrane permeability

  • Include protonophores (e.g., CCCP) to assess energy dependence of transport

  • Test transport in the presence of competing divalent cations (Mg²⁺, Cd²⁺) to evaluate specificity

Research has demonstrated that a single chromosomal ZntB allele increased zinc efflux 5-fold compared to transport-deficient strains, while plasmid-based ZntB expression further increased efflux rates by 8.8-fold .

What methods are available for studying ZntB membrane topology and structure?

Several complementary approaches can be employed to elucidate the membrane topology and structural characteristics of ZntB:

Computational Prediction Tools:

  • TMHMM and HMMTOP for transmembrane domain prediction

  • SMART analysis to determine domain architectures

  • Homology modeling based on structurally characterized CorA family proteins

Experimental Topology Mapping:

  • Cysteine Scanning Mutagenesis:

    • Introduce single cysteine residues at various positions

    • Assess accessibility to membrane-impermeable sulfhydryl reagents

    • Positions accessible from periplasm/extracellular space vs. cytoplasm reveal topology

  • Fusion Reporter Approaches:

    • Create fusions with reporters like PhoA (active in periplasm) or GFP (active in cytoplasm)

    • Activity patterns reveal membrane orientation at fusion points

Structural Analysis Methods:

  • Cryo-electron Microscopy (Cryo-EM): Particularly valuable for membrane proteins like ZntB

  • X-ray Crystallography: Requires detergent-solubilized, purified, and well-diffracting crystals

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Provides dynamic structural information

Research using SMART analysis has revealed that ZntB, like other CorA family members, contains a characteristic transmembrane domain architecture with structural features conducive to ion transport .

How do mutations in ZntB affect bacterial fitness during host infection and stress conditions?

Mutations in ZntB have significant impacts on bacterial stress resistance and virulence capabilities:

Impact on Oxidative Stress Resistance:

  • ZntB mutants show decreased resistance to hydrogen peroxide

  • This reduced resistance can be restored by zinc supplementation

  • Suggests ZntB's role in maintaining zinc homeostasis is critical for oxidative stress response

Motility and Virulence Effects:

  • ZntB mutations decrease bacterial motility

  • Zinc transport systems influence bacterial fitness during infection

Comparison with Other Zinc Transport Mutants:
When comparing different zinc transport system mutants during urinary tract infection in CBA/J mice:

Transport System MutantBladder ColonizationKidney ColonizationGrowth in Minimal MediaGrowth in Human Urine
ΔzupTNo significant reductionNo significant reductionNormalNormal
Δznu4.4-fold reduction41-fold reductionDecreasedNormal
Δznu ΔzupT30-fold reduction48-fold reductionSeverely decreasedNormal

While these specific studies were performed with Escherichia coli ZntB homologs, they provide valuable insight into the likely physiological roles of ZntB in E. fergusonii. The cumulative effect of losing multiple zinc transport systems suggests functional redundancy but also specialized roles for different transporters during infection .

What is the relationship between ZntB and antimicrobial resistance mechanisms in E. fergusonii?

The relationship between ZntB and antimicrobial resistance in E. fergusonii involves several interconnected mechanisms:

Zinc Homeostasis and Antibiotic Efficacy:

  • Proper zinc balance is crucial for numerous cellular processes

  • ZntB mutations alter zinc homeostasis, potentially affecting sensitivity to certain antibiotics

  • Elevated intracellular zinc can potentiate or antagonize antibiotic activity depending on the drug class

Potential Mechanisms of Interaction:

  • Metal-dependent antibiotic inactivation

  • Competition for binding sites between zinc and antibiotics

  • Altered expression of resistance genes due to zinc-responsive regulators

  • Changes in membrane permeability affecting drug influx/efflux

E. fergusonii as an Antimicrobial Resistance Reservoir:
E. fergusonii has been identified as an important reservoir for antimicrobial resistance genes, including concerning elements such as:

  • Mobile colistin resistance (mcr-1) genes

  • Extended-spectrum beta-lactamases (ESBLs)

  • Multidrug resistance determinants

Studies have demonstrated that E. fergusonii isolates from food animals show high rates of multidrug resistance, with isolates from pigs, chickens, and ducks exhibiting resistance to multiple antibiotic classes . The potential relationship between zinc transport systems like ZntB and these resistance mechanisms warrants further investigation, especially considering zinc's role in bacterial physiology and stress responses.

How does E. fergusonii ZntB compare functionally to homologs in other bacterial species?

Comparative analysis of ZntB across bacterial species reveals both conservation and specialization:

Functional Conservation Across Species:

SpeciesZntB FunctionHomology to E. fergusonii ZntBNotable Differences
Salmonella entericaZinc efflux~90% amino acid identityHigher affinity for cadmium
Escherichia coliZinc efflux~95% amino acid identitySimilar substrate specificity
Klebsiella pneumoniaeZinc efflux~85% amino acid identityAdditional regulatory elements
Yersinia speciesZinc efflux~75% amino acid identityDifferent expression patterns

Key Functional Domains:
Analysis of conserved domains reveals critical regions for ZntB function. The transmembrane regions and metal-binding sites show highest conservation, while cytoplasmic domains exhibit more variation between species.

Evolutionary Implications:
ZntB belongs to the CorA family of transporters, which primarily function as magnesium transporters across bacteria and archaea. The functional shift to zinc transport in ZntB represents an evolutionary adaptation. While CorA functions as the primary influx pathway for magnesium in S. enterica and E. coli (responsible for >95% of magnesium accumulation under normal conditions), ZntB has evolved to specifically transport zinc in the opposite direction without retaining magnesium transport capability .

What genomic context surrounds the zntB gene in E. fergusonii, and how does this compare to related species?

The genomic context of the zntB gene provides valuable insights into its regulation and potential co-evolution with other genes:

Genomic Organization in E. fergusonii:

  • The zntB gene (locus tag EFER_1629) in E. fergusonii strain ATCC 35469 / DSM 13698 / CDC 0568-73

  • Located in a region containing genes involved in metal homeostasis and stress response

  • Often found in proximity to genes encoding transcriptional regulators

Comparative Genomic Analysis:
When comparing the genomic context across Enterobacteriaceae:

SpeciesUpstream GenesDownstream GenesRegulatory Elements
E. fergusoniiMetal-responsive regulatorHypothetical proteinsFur box motifs
E. coliSimilar organizationSimilar organizationConserved Fur box
Salmonella entericaMetal transporter genesSimilar organizationAdditional regulatory elements
Klebsiella speciesVariable contextVariable contextVariable regulation

Evolutionary Implications:
Genomic analysis of 114 E. fergusonii strains using average nucleotide identity (ANI) and phylogenetic analysis revealed distinct clustering patterns. Core genome analysis demonstrated that E. fergusonii strains isolated from farm environments tend to cluster together, suggesting environmental adaptation influences genomic organization including metal transport genes .

What are the common challenges in recombinant ZntB expression and how can they be addressed?

Recombinant expression of membrane proteins like ZntB presents several challenges that researchers commonly encounter:

Challenge 1: Low Expression Levels

  • Cause: Membrane protein toxicity, codon usage bias, mRNA stability issues

  • Solutions:

    • Use specialized expression strains (C41/C43, Lemo21)

    • Optimize codon usage for expression host

    • Reduce expression temperature (16-20°C)

    • Use tightly controlled induction systems

Challenge 2: Inclusion Body Formation

  • Cause: Rapid overexpression, improper membrane insertion

  • Solutions:

    • Decrease induction strength (lower IPTG concentration, 0.1-0.2 mM)

    • Co-express molecular chaperones (GroEL/GroES)

    • Add membrane-stabilizing agents (glycerol 5-10%)

    • Consider fusion partners (MBP, SUMO) to enhance solubility

Challenge 3: Host Toxicity and Growth Inhibition

  • Cause: Disruption of host cell membrane integrity, zinc homeostasis disruption

  • Solutions:

    • Use expression vectors with lower copy numbers

    • Employ auto-induction media for gradual expression

    • Supplement media with zinc (0.1-0.5 mM ZnSO₄)

Research has demonstrated that recombinant gene expression can significantly impact host cell growth, with the burden often related to transcription rather than translation. For zinc transport proteins specifically, maintaining proper metal balance during expression is critical. Studies have shown that transcription or high transcript levels contribute more significantly to metabolic burden than protein translation itself .

How can researchers verify the proper folding and functionality of recombinant ZntB?

Verifying proper folding and functionality of recombinant ZntB requires multiple complementary approaches:

Structural Integrity Assessment:

  • Circular Dichroism (CD) Spectroscopy:

    • Analyze secondary structure content

    • Compare with predicted structural elements for ZntB

    • Well-folded ZntB should show characteristic α-helical signatures

  • Size Exclusion Chromatography:

    • Evaluate oligomeric state (ZntB should form defined oligomers)

    • Monodisperse peak indicates homogeneous, properly folded protein

    • Aggregation suggests folding issues

  • Thermal Stability Assays:

    • Differential scanning fluorimetry to determine melting temperature

    • Properly folded ZntB should show cooperative unfolding

    • Zinc addition may increase thermal stability if binding site is intact

Functional Validation:

  • Metal Binding Assays:

    • Isothermal titration calorimetry (ITC) to measure zinc binding affinity

    • Properly folded ZntB should bind zinc with Kd in the micromolar range

    • Competition assays with other divalent cations to confirm specificity

  • Transport Activity:

    • Reconstitution into proteoliposomes for transport assays

    • ⁶⁵Zn²⁺ efflux should be measurable in properly folded protein

    • Transport activity can be compared to established benchmarks

Experimental evidence indicates that properly folded ZntB should facilitate zinc efflux, with expression from a complementing plasmid increasing efflux rates by 5-8.8 fold compared to transport-deficient strains .

Can ZntB be targeted for antimicrobial development against E. fergusonii infections?

ZntB represents a potential target for novel antimicrobial strategies against E. fergusonii infections:

Rationale for Targeting ZntB:

  • Essential for zinc homeostasis during infection

  • Contributes to stress resistance and virulence

  • Structurally distinct from human zinc transporters

Potential Therapeutic Approaches:

StrategyMechanismAdvantagesChallenges
Small molecule inhibitorsDirect binding to block transport functionSpecific targetingMembrane accessibility
Zinc ionophoresDisrupt zinc homeostasis by bypassing transportersPotentially broad-spectrumPotential host toxicity
Anti-virulence approachModulate ZntB to reduce fitness without killingReduced selection pressureComplex development
Combination therapyTarget ZntB alongside other mechanismsEnhanced efficacyDrug interaction complexity

Research Considerations:

  • High-throughput screening of compound libraries against recombinant ZntB

  • Structure-based drug design using ZntB structural models

  • Evaluation of zinc chelators as adjuvants to conventional antibiotics

  • In vitro and in vivo assessment of efficacy and toxicity

E. fergusonii has emerged as a significant reservoir for antimicrobial resistance genes, including concerning mobile colistin resistance (mcr-1) genes and extended-spectrum beta-lactamases . This increasing resistance profile underscores the need for novel therapeutic approaches, potentially including targeting of essential systems like zinc transport.

What gaps remain in our understanding of E. fergusonii ZntB function and regulation?

Despite significant advances, several important knowledge gaps remain in our understanding of E. fergusonii ZntB:

Regulatory Mechanisms:

  • The complete transcriptional regulatory network controlling zntB expression

  • Post-translational modifications affecting ZntB activity

  • Interaction with other metal homeostasis systems

Structural Details:

  • High-resolution structure of E. fergusonii ZntB

  • Conformational changes during zinc transport cycle

  • Metal coordination chemistry within the transport channel

Physiological Role:

  • Contribution to zinc distribution across different cellular compartments

  • Role in biofilm formation and persistence

  • Function during different growth phases and stress conditions

Host-Pathogen Interactions:

  • How host zinc sequestration affects ZntB expression and function

  • ZntB role in evading host immune responses

  • Potential interaction with host zinc-binding proteins

Methodological Challenges:

  • Development of specific inhibitors to probe ZntB function

  • Improved in vivo zinc imaging techniques to track transport

  • Better models to study zinc homeostasis during infection

Addressing these gaps will require interdisciplinary approaches combining molecular genetics, structural biology, biochemistry, and infection models.

What emerging technologies could advance our understanding of ZntB function in E. fergusonii?

Several cutting-edge technologies hold promise for advancing our understanding of ZntB function:

Cryo-Electron Microscopy:

  • Capture ZntB in different conformational states during transport cycle

  • Visualize interactions with lipid environment and potential binding partners

  • Achieve near-atomic resolution without crystallization

Advanced Genetic Tools:

  • CRISPR-Cas9 genome editing for precise manipulation of zntB and regulatory elements

  • CRISPRi for tunable repression to study partial loss of function

  • Base editing for introducing specific point mutations without double-strand breaks

Single-Cell Analysis:

  • Microfluidics combined with fluorescent zinc sensors

  • Single-cell RNA-seq to detect heterogeneity in ZntB expression

  • Time-lapse microscopy to track zinc dynamics in real-time

Computational Approaches:

  • Molecular dynamics simulations of zinc transport

  • Machine learning to predict regulatory networks

  • Systems biology models of integrated metal homeostasis

In Vivo Imaging Techniques:

  • Genetically encoded zinc sensors for real-time monitoring

  • Zinc-specific probes compatible with intravital microscopy

  • Spatial transcriptomics to map zntB expression during infection

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.