Recombinant ESX-1 secretion system protein EccCa1 (eccCa1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-747
Protein Length
full length protein
Target Names
eccCa1
Target Protein Sequence
MTTKKFTPTITRGPRLTPGEISLTPPDDLGIDIPPSGVQKILPYVMGGAMLGMIAIMVAG GTRQLSPYMLMMPLMMIVMMVGGLAGSTGGGGKKVPEINADRKEYLRYLAGLRTRVTSSA TSQVAFFSYHAPHPEDLLSIVGTQRQWSRPANADFYAATRIGIGDQPAVDRLLKPAVGGE LAAASAAPQPFLEPVSHMWVVKFLRTHGLIHDCPKLLQLRTFPTIAIGGDLAGAAGLMTA MICHLAVFHPPDLLQIRVLTEEPDDPDWSWLKWLPHVQHQTETDAAGSTRLIFTRQEGLS DLAARGPHAPDSLPGGPYVVVVDLTGGKAGFPPDGRAGVTVITLGNHRGSAYRIRVHEDG TADDRLPNQSFRQVTSVTDRMSPQQASRIARKLAGWSITGTILDKTSRVQKKVATDWHQL VGAQSVEEITPSRWRMYTDTDRDRLKIPFGHELKTGNVMYLDIKEGAEFGAGPHGMLIGT TGSGKSEFLRTLILSLVAMTHPDQVNLLLTDFKGGSTFLGMEKLPHTAAVVTNMAEEAEL VSRMGEVLTGELDRRQSILRQAGMKVGAAGALSGVAEYEKYRERGADLPPLPTLFVVVDE FAELLQSHPDFIGLFDRICRVGRSLRVHLLLATQSLQTGGVRIDKLEPNLTYRIALRTTS SHESKAVIGTPEAQYITNKESGVGFLRVGMEDPVKFSTFYISGPYMPPAAGVETNGEAGG PGQQTTRQAARIHRFTAAPVLEEAPTP
Uniprot No.

Q&A

What is the ESX-1 secretion system and what role does EccCa1 play in it?

The ESX-1 (ESAT-6 secretion system 1) is a specialized Type VII secretion system essential for virulence in pathogenic mycobacteria, including Mycobacterium tuberculosis and Mycobacterium marinum. This system secretes proteins required for mycobacterial survival in host immune cells. The ESX-1 secretion apparatus consists of a multi-subunit membrane complex predicted to form a pore in the cytoplasmic membrane .

The membrane complex is composed of five primary membrane proteins: EccB1, EccCa1, EccCb1, EccD1, and EccE1. EccCa1 specifically functions as an essential component of the secretory apparatus and contains AAA ATPase domains that likely provide energy for substrate transport . EccCa1 works in conjunction with EccCb1, with both proteins playing critical roles in substrate recognition and the mechanics of protein transport across the mycobacterial cell envelope .

How does the ESX-1 system contribute to mycobacterial pathogenesis?

The ESX-1 secretion system contributes to mycobacterial pathogenesis through multiple mechanisms:

  • It secretes virulence factors and immunogenic effectors required for disease progression

  • It enables mycobacterial survival within host immune cells

  • It facilitates bacterial escape from the phagosome into the cytosol

  • It mediates host cell death

The importance of ESX-1 in pathogenesis is highlighted by the fact that the primary attenuating deletion in the Mycobacterium bovis BCG vaccine strain is the loss of eight genes (RD1) from the esx-1 locus . When these genes are reintroduced to attenuated strains, virulence is partially restored .

Research has shown that mutants lacking functional ESX-1 components exhibit significant growth defects in macrophages, demonstrating its essential role in intracellular survival .

What are the known substrates of the ESX-1 secretion system?

The ESX-1 secretion system transports multiple protein substrates that contribute to virulence. Current research has identified several key substrates:

Substrate CategorySpecific ProteinsFunctionReference
Esx ProteinsEsxA (ESAT-6), EsxB (CFP-10)Form a tight 1:1 complex; essential for secretion of other ESX-1 substrates
Esp ProteinsEspA, EspB, EspC, EspD, EspE, EspF, EspJ, EspKVarious roles in secretion and regulation
PE/PPE ProteinsPPE68, PE35Central role in secretion of other ESX-1 substrates

Importantly, research has demonstrated a hierarchical organization of substrate secretion, where certain substrates must be secreted before others can be transported. For example, EsxA and EsxB are required for the secretion of many other ESX-1 substrates . Similarly, PPE68 has been shown to be essential for the secretion of EsxA and EspE in M. marinum .

What are the best expression systems for producing recombinant EccCa1 protein?

Based on commercial availability and research protocols, several expression systems have been successfully used to produce recombinant ESX-1 secretion system protein EccCa1:

Expression SystemAdvantagesConsiderationsReference
E. coliHigh yield, cost-effective, rapid productionMay lack post-translational modifications; potential solubility issues
YeastBetter post-translational processing than E. coliModerate yield, longer production time
BaculovirusCloser to native protein structure, better foldingHigher cost, more complex production process
Mammalian CellMost natural post-translational modificationsLowest yield, highest cost
Cell-Free ExpressionRapid production, avoids toxicity issuesLower yield, higher cost

When selecting an expression system, researchers should consider their specific experimental needs. For structural studies requiring large amounts of protein, E. coli systems may be preferable. For functional studies where post-translational modifications are critical, mammalian or baculovirus systems might be more appropriate. Most commercially available recombinant EccCa1 proteins achieve ≥85% purity as determined by SDS-PAGE .

How can I assess the ATPase activity of recombinant EccCa1/EccCb1 proteins?

The ATPase activity of EccCa1 and related proteins can be assessed through several methodological approaches:

  • Colorimetric ATPase assays: Measure the release of inorganic phosphate during ATP hydrolysis using malachite green or similar colorimetric reagents

  • Coupled enzyme assays: Link ATPase activity to NADH oxidation through pyruvate kinase and lactate dehydrogenase, measuring the decrease in NADH absorbance at 340 nm

  • Radiolabeled ATP assays: Use [γ-32P]ATP and measure the release of 32P after hydrolysis

For EccCb1 specifically, research has demonstrated the formation of oligomeric structures (double hexameric rings) in solution that correlate with ATPase activity. Structural analysis using small-angle X-ray scattering (SAXS) revealed:

  • Radius of gyration (Rg) compatible with theoretical values

  • Maximum particle diameter (Dmax) consistent with a double hexameric ring structure

  • Ab initio envelope obtained from SAXS data indicates the presence of double hexameric ring structure in solution

When designing experiments to assess ATPase activity, it's important to consider that substrate binding (such as EsxA/EsxB) may affect the ATPase activity of EccCa1/EccCb1 proteins.

What experimental approaches can be used to study EccCa1 interactions with other ESX-1 components?

Multiple experimental approaches have proven effective for studying protein-protein interactions within the ESX-1 system:

  • Co-immunoprecipitation (Co-IP): Using antibodies against EccCa1 or tagged versions of the protein to pull down interacting partners

  • Bacterial two-hybrid assays: For detecting binary protein interactions in a bacterial host system

  • Surface plasmon resonance (SPR): To measure binding kinetics and affinity constants between EccCa1 and other components

  • Crosslinking coupled with mass spectrometry: To identify interaction interfaces and transient interactions

  • Blue Native PAGE: For analyzing intact membrane protein complexes

Research has shown that EccCa1 works closely with EccCb1, with both proteins interacting directly with secretion substrates. For instance, the C-terminal 7 amino acids of EsxB (LSSQMGF) interact directly with the C-terminal half of EccCb1, specifically with its third AAA ATPase domain . Similar methodologies could be applied to study EccCa1 interactions.

For membrane complex formation studies, researchers have successfully employed biochemical isolation followed by proteomic analysis to identify interacting partners. This approach revealed that deletion of EccE1 lowers the levels of EccB1, EccCa1, and EccD1, suggesting these proteins form a stable complex that requires all components for proper assembly .

How does the hierarchical secretion pathway of ESX-1 substrates influence experimental design when studying EccCa1 function?

Understanding the hierarchical nature of ESX-1 secretion is crucial when designing experiments to study EccCa1 function. Research has established distinct groups of substrates with different dependencies:

GroupSubstratesDependencyReference
Group IEsxA, EsxBCore components (EccCa1, EccCb1)
Group IIEspB, EspJ, EspKRequire Group I for secretion
Group IIIEspE, EspFRequire Groups I and II for secretion

When designing experiments to study EccCa1 function, consider:

  • Substrate Selection: Measure multiple substrate groups to fully assess EccCa1 function. Measuring only EsxA/EsxB secretion may not reveal partial defects affecting later-stage substrates.

  • Control Selection: Include both positive controls (wild-type) and negative controls (complete ESX-1 deletion) alongside your EccCa1 mutants.

  • Complementation Studies: Design complementation constructs that restore not only EccCa1 but maintain proper stoichiometry with other complex components.

  • Feedback Mechanisms: Account for regulatory feedback loops. For example, disruption of ESX-1 secretion can downregulate esxA expression through a WhiB6-controlled negative feedback mechanism .

A comprehensive proteo-genetic analysis in M. marinum revealed that different ESX-1 substrates make distinct contributions to the secretion of other proteins. Mutants lacking secretion of multiple substrates showed more marked growth defects in macrophages than mutants lacking secretion of only one substrate .

What structural insights into EccCa1 have been revealed through recent research, and how do they inform functional studies?

Recent structural studies have provided valuable insights into the organization and function of ESX-1 components, including EccCa1:

  • Membrane Complex Organization: The ESX-1 membrane complex consists of five membrane proteins (EccB1, EccCa1, EccCb1, EccD1, and EccE1) that form a channel across the cytoplasmic membrane . EccCa1 and EccCb1 provide energy for transport through their conserved AAA ATPase domains.

  • ATPase Domain Function: The ATPase domains of EccCb1 (and likely EccCa1 by homology) directly interact with substrate proteins. The third AAA ATPase domain of EccCb1 interacts with the C-terminal 7 amino acids of EsxB, promoting oligomerization of EccCb1 .

  • Oligomeric States: SAXS analysis of EccCb1 has revealed a double hexameric ring structure in solution, with NSD value ~0.883±0.132 and resolution ~9.7±0.7 nm. The theoretical Rg and Dmax values were compatible with experimental values .

When designing functional studies:

  • Consider how mutations in specific domains might affect both ATP hydrolysis and substrate binding

  • Investigate how oligomerization states correlate with ATPase activity and substrate secretion

  • Examine how complex assembly affects protein stability and localization

Research has shown that EccE1 is required for stable complex formation at the poles of M. tuberculosis, and its deletion leads to decreased levels of other membrane components including EccCa1 . This suggests that proper localization and complex formation are essential for function.

How do differences in ESX-1 systems between mycobacterial species impact the generalizability of EccCa1 research findings?

While ESX-1 systems share core components across mycobacterial species, there are important differences that researchers must consider when generalizing findings:

When designing experiments with recombinant EccCa1:

  • Clearly document the species source of your recombinant protein

  • Consider testing proteins from multiple species if cross-species comparisons are important

  • Be cautious about generalizing regulatory mechanisms across species

Research has shown that while the core ESX-1 components are conserved, there can be species-specific differences in regulation. For example, a study demonstrated that deletion of espG1 in M. marinum results in a general secretion defect of PE/PPE substrates, Esx substrates, and Esp proteins, suggesting a central role for PE/PPE substrates in secretion . This relationship may vary in other species.

What are common challenges in obtaining functionally active recombinant EccCa1, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant EccCa1:

  • Protein Solubility: As a membrane-associated protein, EccCa1 can present solubility challenges.

    • Solution: Use detergents optimized for membrane proteins; consider fusion tags that enhance solubility; explore refolding protocols from inclusion bodies

  • Complex Formation: EccCa1 may require other ESX-1 components for stability and proper folding.

    • Solution: Co-express with interaction partners like EccCb1; use stabilizing buffer conditions

  • ATPase Activity: Recombinant protein may lack expected ATPase activity.

    • Solution: Ensure proper folding; supplement with required co-factors; verify protein integrity by limited proteolysis

  • Post-translational Modifications: Important modifications may be absent in heterologous expression systems.

    • Solution: Choose expression systems that can perform required modifications; characterize the post-translational modification status of your recombinant protein

Recent research shows that EccCa1 interacts with multiple ESX-1 components and deletion of certain components (like EccE1) lowers EccCa1 levels . This suggests that stability of EccCa1 depends on proper complex formation, which should be considered when designing expression and purification protocols.

How can I validate the functional activity of purified recombinant EccCa1 protein?

Validating the functional activity of recombinant EccCa1 requires a multi-faceted approach:

  • ATPase Activity Assays:

    • Measure ATP hydrolysis using established ATPase assays

    • Compare activity to known standards or wild-type controls

    • Test activity in the presence of potential substrates or interaction partners

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Thermal shift assays to evaluate protein stability

    • Limited proteolysis to verify proper folding

  • Interaction Studies:

    • Verify binding to known partners (e.g., EccCb1)

    • Confirm substrate interactions (e.g., with EsxA/EsxB complex)

    • Surface plasmon resonance or isothermal titration calorimetry for quantitative binding analysis

  • Functional Complementation:

    • If possible, test whether your recombinant protein can complement EccCa1-deficient mycobacterial strains

    • Measure restoration of ESX-1 secretion in complemented strains

Research has shown that EccCa1 is part of a complex functional unit. For example, studies demonstrate that EccCb1 directly interacts with the C-terminal 7 amino acids of EsxB through its third AAA ATPase domain . Similar interactions might occur with EccCa1 and could be used to validate protein function.

What experimental approaches could resolve current contradictions in EccCa1 research findings?

Several contradictions or knowledge gaps exist in current EccCa1 research that could be addressed through targeted experimental approaches:

  • Substrate Specificity Contradictions:

    • Some studies suggest EccCa1 and EccCb1 have distinct substrate preferences, while others indicate overlapping functions

    • Approach: Systematic mutagenesis of ATPase domains coupled with in vitro and in vivo secretion assays for different substrates

  • Assembly Sequence of ESX-1 Complex:

    • The order of assembly of the ESX-1 complex components remains unclear

    • Approach: Time-resolved cryo-electron microscopy or pulse-chase experiments with fluorescently tagged components

  • Species-Specific Differences:

    • Contradictory findings between M. tuberculosis and M. marinum systems

    • Approach: Direct comparative studies using identical methodologies across species; chimeric proteins with domains from different species

  • Role in DNA Transfer:

    • Some studies suggest ESX-1 involvement in conjugal DNA transfer in Mycobacterium smegmatis , but the specific role of EccCa1 is unclear

    • Approach: Targeted studies of DNA transfer efficiency with EccCa1 mutations or domain swaps

A particularly interesting contradiction involves EspB secretion. While most ESX-1 secretion is abolished by deletion of EccE1, research has shown that "secretion of EspB was not affected by loss of EccE1" . This suggests a potential alternative secretion pathway for EspB that could be explored through comparative proteomics and secretion assays.

How might understanding EccCa1 function contribute to novel therapeutic approaches for mycobacterial infections?

The essential role of ESX-1 and EccCa1 in mycobacterial virulence makes them attractive targets for therapeutic intervention:

  • Inhibitor Development:

    • ATPase activity of EccCa1 could be targeted with small molecule inhibitors

    • Structure-based drug design focusing on the ATP-binding pocket

    • High-throughput screening of compound libraries against EccCa1 activity

  • Disruption of Protein-Protein Interactions:

    • Peptide mimetics targeting the interaction interfaces between EccCa1 and other ESX-1 components

    • Small molecules disrupting EccCa1 oligomerization or complex formation

  • Vaccine Development:

    • Understanding EccCa1's role in ESX-1 function could inform rational attenuation strategies for live vaccines

    • Research has shown that recombinant M. bovis BCG strains expressing M. tuberculosis genes in the extended RD1 region demonstrated increased protection against M. tuberculosis infection in animal models

  • Diagnostic Applications:

    • Detection of ESX-1 secreted products as biomarkers of active infection

    • Immunological assays targeting ESX-1 components or secreted products

The hierarchical nature of ESX-1 secretion suggests that targeting EccCa1 could have broad downstream effects on multiple virulence factors. Studies have shown that mutants lacking secretion of multiple substrates have more marked growth defects in macrophages than mutants lacking secretion of only one substrate , indicating that a therapeutic approach targeting EccCa1 could have potent antimycobacterial effects.

What are the key controls needed when designing experiments to study EccCa1 function in the context of the ESX-1 system?

Robust experimental design requires careful consideration of appropriate controls:

  • Positive Controls:

    • Wild-type mycobacterial strains with intact ESX-1 function

    • Purified recombinant EccCa1 with confirmed activity

    • Complemented EccCa1 mutant strains showing restored ESX-1 function

  • Negative Controls:

    • Complete ESX-1 deletion strains (e.g., ΔRD1)

    • EccCa1 deletion strains

    • Catalytically inactive EccCa1 mutants (e.g., mutations in ATPase domains)

  • Specificity Controls:

    • Mutations in other ESX-1 components to differentiate EccCa1-specific effects

    • ESX-1-independent secretion markers to confirm specificity of secretion defects

    • Controls for non-specific effects on bacterial growth or membrane integrity

  • Technical Controls:

    • Loading controls for Western blots (e.g., GroEL2, RpoB)

    • Controls for cell lysis when analyzing secreted proteins

    • Controls for proper subcellular fractionation

Research has demonstrated the importance of comprehensive controls. For example, studies investigating the effect of EccE1 deletion on ESX-1 function included controls for drug susceptibility to verify that membrane integrity was not generally compromised . Similarly, when analyzing intracellular proteomes, researchers included controls like GroEL2 and RpoB to ensure equal loading and sample preparation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.