Recombinant ESX-2 secretion system protein eccB2 (eccB2)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics of EccB2

EccB2 is an ATPase specific to the ESX-2 secretion system, which is prevalent in slow-growing mycobacterial species like Mycobacterium tuberculosis (Mtb). Key features include:

  • Role in ESX-2: EccB2 provides energy for substrate transport across the mycobacterial cell envelope .

  • Structural Interaction: Forms part of the transmembrane EccB-E complex, critical for protein translocation .

  • Genetic Conservation: Encoded within the ESX-2 loci, which includes pe and ppe68 genes linked to PE/PPE protein secretion .

Research Applications

Recombinant EccB2 is instrumental in:

  • Mechanistic Studies: Elucidating ATP-dependent transport mechanisms in ESX-2 .

  • Vaccine Development: ESX systems (e.g., ESX-3 in M. smegmatis) are explored as vaccine candidates, and EccB2 could inform similar strategies .

  • Protein Interaction Mapping: Identifying interactions with EccE2 (transmembrane component) and other ESX-2 effectors .

Current Research Insights

  • Functional Redundancy: ESX-2 is non-functional in Mycobacterium leprae, suggesting species-specific adaptations .

  • Evolutionary Context: ESX-2 likely evolved via genomic duplication from ancestral ESX-1/ESX-3 systems .

  • Host-Pathogen Dynamics: ESX-2 aids mycobacterial survival in dendritic cells, though its direct role in virulence remains unclear .

Challenges and Future Directions

  • Structural Resolution: High-resolution structures of EccB2-ESX-2 complexes are needed to map secretion mechanisms.

  • Pathogenicity Links: Further studies are required to clarify ESX-2’s contribution to mycobacterial virulence compared to ESX-1/ESX-3 .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request when possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1–1.0 mg/mL. We recommend adding 5–50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-495
Protein Length
full length protein
Target Names
eccB2
Target Protein Sequence
MPLSLSNRDQNSGHLFYNRRLRAATTRFSVRMKHDDRKQTAALALSMVLVAIAAGWMMLL NVLKPTGIVGDSAIIGDRDSGALYARIDGRLYPALNLTSARLATGTAGQPTWVKPAEIAK YPTGPLVGIPGAPAAMPVNRGAVSAWAVCDTAGRPRSADKPVVTSIAGPITGGGRATHLR DDAGLLVTFDGSTYVIWGGKRSQIDPTNRAVTLSLGLDPGVTSPIQISRALFDGLPATEP LRVPAVPEAGTPSTWVPGARVGSVLQAQTAGGGSQFYVLLPDGVQKISSFVADLLRSANS YGAAAPRVVTPDVLVHTPQVTSLPVEYYPAGRLNFVDTAADPTTCVSWEKASTDPQARVA VYNGRGLPVPPSMDSRIVRLVRDDRAPASVVATQVLVLPGAANFVTSTSGVITAESRESL FWVSGNGVRFGIANDEATLRALGLDPGAAVQAPWPLLRTFAAGPALSRDAALLARDTVPT LGQVAIVTTTAKAGA
Uniprot No.

Q&A

What is the ESX-2 secretion system and what is the role of EccB2 within it?

The ESX-2 secretion system is one of five Type VII secretion systems (T7SS) found in mycobacteria. Based on structural and functional studies of homologous ESX systems, EccB2 serves as a critical structural component of the membrane complex. In characterized ESX systems, EccB proteins contain a periplasmic domain that likely anchors the secretion apparatus to the cell wall through peptidoglycan interaction .

Methodologically, to investigate EccB2's specific function, researchers should employ:

  • Gene deletion studies to assess phenotypic changes

  • Protein-protein interaction assays (pull-down experiments, bacterial two-hybrid)

  • Fluorescently-tagged protein localization studies

  • Complementation experiments in eccB2 knockout strains

  • Structural analysis via cryo-EM or X-ray crystallography

These approaches have revealed that in other ESX systems, EccB proteins form part of a hexameric membrane complex with other Ecc proteins, creating a secretion channel that spans the mycobacterial cell envelope .

How does EccB2 compare structurally with other EccB proteins in different ESX systems?

Structural comparison of EccB2 with other EccB proteins reveals both conserved features and system-specific differences:

FeatureEccB1EccB2EccB3EccB5
Domain organizationN-terminal TM, large periplasmic domainN-terminal TM, large periplasmic domainN-terminal TM, large periplasmic domainN-terminal TM, large periplasmic domain
Periplasmic structure4 repeat domains and central domainPredicted similar organizationPart of hexameric complexPart of hexameric complex
FunctionMembrane complex componentLess characterizedMembrane complex componentMembrane complex component
Potential binding partnersMycP1, EccD1Predicted: EccC2, EccD2EccC3, EccD3, EccE3EccC5, EccD5, EccE5

For experimental characterization, researchers should:

  • Perform multiple sequence alignments using tools like Clustal Omega

  • Use AlphaFold or RoseTTAFold to generate structural models

  • Compare with experimentally determined structures of other EccB proteins

  • Analyze whether peptidoglycan-binding motifs are conserved in EccB2

The periplasmic domain of EccB1 consists of a central domain flanked by repeat domains that form a quasi 2-fold symmetrical structure , which may provide insights into EccB2's structure.

What are the common methods for expressing and purifying recombinant EccB2?

Effective expression and purification of recombinant EccB2 typically follows these methodological approaches:

Expression systems:

  • E. coli systems (BL21(DE3), Rosetta) are commonly used for cytoplasmic domains

  • Mycobacterium smegmatis expression for better folding of full-length protein

  • Baculovirus-infected insect cells for membrane proteins

Expression strategies:

  • Use of solubility tags (His, MBP, SUMO) to enhance protein solubility

  • Codon optimization for the expression host

  • Inducible promoters (T7, tet) for controlled expression

  • Lower temperature cultivation (16-20°C) to improve folding

Purification protocol:

  • Cell lysis: Sonication or French press

  • Initial capture: IMAC for His-tagged proteins

  • Intermediate purification: Ion exchange chromatography

  • Polishing: Size exclusion chromatography

  • Quality control: SDS-PAGE, Western blot, mass spectrometry

For membrane-associated regions:

  • Detergent screening (DDM, LDAO, OG) for solubilization

  • Amphipol or nanodisc reconstitution for stabilization

According to product information, recombinant EccB2 has been successfully expressed in E. coli with an N-terminal His tag .

What experimental approaches are most effective for studying the function of EccB2 in vitro?

Studying EccB2 function in vitro requires specialized methodological approaches:

Protein-protein interaction studies:

  • Pull-down assays using His-tagged EccB2 as bait

  • Surface plasmon resonance for measuring binding kinetics

  • Isothermal titration calorimetry for thermodynamic parameters

  • Crosslinking mass spectrometry to map interaction interfaces

Structural approaches:

Functional reconstitution:

  • Liposome reconstitution assays to test membrane integration

  • In vitro secretion assays using artificial membrane systems

  • Fluorescence-based assays to monitor protein translocation

Biophysical characterization:

  • Thermal stability assays to assess structural integrity

  • Limited proteolysis to identify flexible regions

  • Circular dichroism spectroscopy for secondary structure analysis

These approaches should be combined in a systematic workflow starting with binary protein-protein interactions and progressing to reconstitution of larger subcomplexes, as demonstrated in studies of other ESX systems .

What are the known or predicted interaction partners of EccB2 in the ESX-2 system?

Based on studies of other ESX systems, EccB2 likely interacts with multiple partners within the ESX-2 secretion system:

Core complex components:

  • EccC2: The ATPase component that provides energy for secretion

  • EccD2: Transmembrane component forming the translocation channel

  • EccE2: Membrane-associated component stabilizing the complex

ESX SystemKnown InteractionsValidated MethodsReference
ESX-1EccB1-EccD1, EccB1-MycP1Co-purification
ESX-3EccB3-EccC3-EccD3-EccE3Cryo-EM
ESX-5EccB5-EccC5-EccD5-EccE5Membrane complex isolation
ESX-2Predicted: Similar to other systemsNot fully validated-

Interaction mapping approaches:

  • Co-immunoprecipitation using anti-EccB2 antibodies

  • Bacterial two-hybrid for binary protein interactions

  • Proximity labeling (BioID or APEX2) fused to EccB2

  • Crosslinking-mass spectrometry to capture transient interactions

From structural studies, we know that in ESX-3, "The ESX-3 protomer complex is assembled from a single copy of the EccB3, EccC3, and EccE3 and two copies of the EccD3 protein" . This suggests EccB2 likely forms similar stoichiometric relationships with its ESX-2 partners.

When designing experiments with recombinant EccB2, several methodological considerations are critical:

Sample preparation:

  • Storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Addition of glycerol (final concentration 5-50%) for long-term storage

  • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

  • Aliquoting to avoid freeze-thaw cycles, which significantly impact stability

Experimental controls:

  • Include properly folded EccB2 positive control

  • Use denatured EccB2 as negative control

  • Include other EccB family proteins for specificity testing

Replication strategy:

  • Implement biological replicates (different protein preparations)

  • Avoid confounding variables by standardizing expression and purification protocols

  • Address batch effects through randomized block design

Statistical considerations:

  • Power analysis to determine appropriate sample size

  • Randomization to minimize bias

  • Blinding during data analysis when possible

Specific assay considerations:

  • For binding assays: account for non-specific binding

  • For structural studies: assess sample homogeneity

  • For functional studies: validate activity using multiple approaches

Proper experimental design with sufficient replication is essential, as "biological replicates are absolutely essential" for robust data analysis .

How can I validate the activity of recombinant EccB2 after purification?

Validating EccB2 activity requires multiple complementary approaches:

Structural integrity assessment:

  • Circular dichroism spectroscopy to confirm secondary structure content

  • Thermal shift assays to measure protein stability

  • Size exclusion chromatography to verify oligomeric state

  • SDS-PAGE to assess purity (>90% as indicated for commercial preparations)

Functional validation steps:

  • Binding assays with other ESX-2 components:

    • Pull-down experiments with purified EccC2, EccD2, EccE2

    • AlphaScreen or ELISA-based interaction assays

    • Microscale thermophoresis to quantify binding affinity

  • Complementation assays:

    • Introduction of purified EccB2 into membrane vesicles from EccB2-deficient strains

    • Functional rescue of EccB2 knockout strains

  • Assembly assays:

    • Native PAGE to monitor formation of higher-order complexes

    • Electron microscopy to visualize complex assembly

For membrane-associated forms, reconstitution into liposomes or nanodiscs followed by substrate binding assays provides the most physiologically relevant validation.

How can cryo-electron microscopy be optimized for studying the structure of EccB2 within the ESX-2 complex?

Optimizing cryo-EM for EccB2 structural studies involves several critical methodological considerations:

Sample preparation optimization:

  • Protein expression and purification:

    • Scale-up production for higher yields

    • Optimize buffer conditions for complex stability

    • Use nanobodies or Fab fragments to stabilize flexible regions

  • Complex assembly:

    • Co-expression of multiple components

    • Controlled reconstitution into membrane mimetics

    • Crosslinking strategies to stabilize transient interactions

  • Cryo-EM grid preparation:

    • Optimize protein concentration (typically 0.5-5 mg/ml)

    • Screen detergents or amphipols to reduce aggregation

    • Test different grid types (Quantifoil, C-flat)

    • Evaluate additives to improve particle distribution

Data collection parameters:

ParameterOptimization ApproachImpact
Electron dose40-60 e-/Ų totalBalance signal vs. radiation damage
Defocus range-0.8 to -2.5 μmEnhance contrast
Pixel size0.8-1.2 Å/pixelBalance resolution vs. field of view
Motion correctionDose-weightingMitigate beam-induced damage
Energy filter20 eV slitImprove contrast

Image processing approaches:

  • Deep learning-based particle picking for heterogeneous samples

  • 3D variability analysis to capture conformational states

  • Focused refinement targeting specific regions (e.g., EccB2 periplasmic domain)

  • Multi-body refinement to account for domain flexibility

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.