Recombinant ESX-2 secretion system protein EccE2 (eccE2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-537
Protein Length
full length protein
Target Names
eccE2
Target Protein Sequence
MTSKLTGFSPRSARRVAGVWTVFVLASAGWALGGQLGAVMAVVVGVALVFVQWWGQPAWS WAVLGLRGRRPVKWNDPITLANNRSGGGVRVQDGVAVVAVQLLGRAHRATTVTGSVTVES DNVIDVVELAPLLRHPLDLELDSISVVTFGSRTGTVGDYPRVYDAEIGTPPYAGRRETWL IMRLPVIGNTQALRWRTSVGAAAISVAQRVASSLRCQGLRAKLATATDLAELDRRLGSDA VAGSAQRWKAIRGEAGWMTTYAYPAEAISSRVLSQAWTLRADEVIQNVTVYPDATCTATI TVRTPTPAPTPPSVILRRLNGEQAAAAAANMCGPRPHLRGQRRCPLPAQLVTEIGPSGVL IGKLSNGDRLMIPVTDAGELSRVFVAADDTIAKRIVIRVVGAGERVCVHTRDQERWASVR MPQLSIVGTPRPAPRTTVGVVEYVRRRKNGDDGKSEGSGVDVAISPTPRPASVITIARPG TSLSESDRHGFEVTIEQIDRATVKVGAAGQNWLVEMEMFRAENRYVSLEPVTMSIGR
Uniprot No.

Q&A

What is EccE2 and what is its role in the ESX-2 secretion system?

EccE2 is a membrane protein component of the ESX-2 secretion system in mycobacteria. It works in conjunction with other ESX-2 components (eccB2, eccC2, and eccD2) to facilitate the transportation of secretory antigens across the cytoplasm . While less extensively studied than proteins in the ESX-1 system, EccE2 is believed to play a structural role in maintaining the integrity of the secretion apparatus and potentially in substrate recognition.

How does EccE2 interact with other components of the ESX-2 secretion system?

EccE2 forms a complex with other membrane proteins of the ESX-2 system, including eccB2, eccC2, and eccD2 . These interactions create a membrane-spanning channel that enables the secretion of specific mycobacterial proteins. Protein interaction analyses like STRING (as used for the related Rv3899c protein) can predict these interactions . The quaternary structure of this complex is essential for proper functioning of the secretion machinery.

Which mycobacterial species express functional EccE2 proteins?

Based on available research data, EccE2 has been identified in several mycobacterial species including Mycobacterium tuberculosis H37Rv . Homologs likely exist in other mycobacterial species including M. haemophilum, M. smegmatis, and M. marinum, as these species have been shown to possess components of ESX secretion systems . Comparative genomic analyses would be required to determine the complete distribution of this protein across the Mycobacterium genus.

What are the recommended protocols for recombinant expression of EccE2?

Recommended Expression Protocol:

  • Vector selection: Use pET-based vectors with C-terminal His-tag for purification

  • Expression host: E. coli BL21(DE3) or C41/C43 strains (optimized for membrane proteins)

  • Culture conditions:

    • LB medium supplemented with appropriate antibiotics

    • Grow at 37°C until OD600 of 0.6-0.8

    • Induce with 0.5-1.0 mM IPTG

    • Reduce temperature to 18°C post-induction

    • Continue expression for 16-18 hours

  • Cell lysis:

    • Mechanical disruption (sonication or high-pressure homogenization)

    • In buffer containing protease inhibitors and appropriate detergents

For structural studies, approaches similar to those used for EspB proteins could be adapted, including preparation for electron microscopy analysis .

What experimental approaches are suitable for studying EccE2 interactions with other ESX-2 components?

ApproachAdvantageLimitationControl Recommendation
Co-immunoprecipitationDetects native complexesRequires specific antibodiesIgG control, unrelated protein control
Bacterial two-hybridIn vivo interaction detectionPotential false positivesEmpty vector controls
Surface plasmon resonanceQuantitative binding dataRequires purified proteinsBSA as non-binding control
Cross-linking mass spectrometryIdentifies interaction interfacesComplex data analysisNon-cross-linked samples
STRING analysisComputational predictionRequires validationStatistical significance assessment

When designing interaction studies, researchers should implement a completely randomized design with appropriate controls as outlined in experimental design literature . This ensures that observed interactions are not due to confounding variables.

How should protein pull-down assays be designed to study EccE2 complexes?

For robust protein pull-down assays to study EccE2 complexes:

  • Sample preparation:

    • Express EccE2 with affinity tag (His, GST, etc.)

    • Prepare membrane fractions carefully to maintain protein-protein interactions

    • Solubilize using mild detergents (DDM, LMNG) at 2-3× CMC

  • Assay design considerations:

    • Include negative controls (unrelated tagged protein)

    • Include competition controls with untagged protein

    • Maintain consistent buffer conditions throughout

  • Statistical considerations:

    • Perform at least three biological replicates

    • Use randomized design principles to minimize bias

    • Quantify results using densitometry with appropriate normalization

  • Validation approaches:

    • Confirm interactions using orthogonal methods

    • Perform reverse pull-downs with different tagged partners

    • Analyze samples by mass spectrometry for comprehensive interaction mapping

How do mutations in eccE2 affect the functionality of the ESX-2 secretion system?

Systematic mutation analysis of eccE2 reveals structure-function relationships within the ESX-2 system. Based on approaches used for related secretion systems:

  • Critical functional domains:

    • Transmembrane regions: Essential for membrane integration

    • Cytoplasmic domains: Important for protein-protein interactions with other ESX-2 components

    • Conserved residues: Often critical for function across mycobacterial species

  • Experimental approaches for mutational analysis:

    • Site-directed mutagenesis targeting conserved residues

    • Domain swapping with homologous proteins from other ESX systems

    • Complementation studies in eccE2-deficient strains

  • Functional readouts:

    • Protein complex formation (co-immunoprecipitation)

    • Substrate secretion efficiency

    • Membrane localization of the complex

    • Mycobacterial growth and virulence phenotypes

When designing mutation studies, researchers should implement appropriate experimental controls and statistical analysis methods as outlined in evidence-based research protocols .

What is the role of EccE2 in mycobacterial pathogenesis compared to other ESX systems?

While ESX-1 is well-established as a virulence determinant, the role of ESX-2 and specifically EccE2 in pathogenesis remains less characterized. Comparative analysis between ESX systems reveals:

  • Functional differentiation:

    • ESX-1: Major virulence determinant involved in phagosomal escape

    • ESX-3: Essential for metal acquisition

    • ESX-5: Required for secretion of PE/PPE proteins

    • ESX-2: Less characterized; potentially involved in cell envelope maintenance

  • Research approaches to determine EccE2's role:

    • Generate eccE2 knockout strains and assess virulence in cellular and animal models

    • Compare transcriptional responses to infection with wild-type versus eccE2-deficient strains

    • Investigate interactions with host immune components

    • Examine potential substrate proteins (possibly including PPE26 and PPE65, which interact with some ESX system components)

  • Quantitative assessment methodologies:

    • Bacterial survival in macrophages

    • Cytokine production measurements

    • Histopathological scoring in animal models

    • Transcriptomics and proteomics of host responses

How can researchers differentiate between direct and indirect effects when studying EccE2 mutants?

Distinguishing direct from indirect effects is crucial for accurate interpretation of eccE2 mutation studies:

  • Experimental strategies:

    • Complementation with wild-type eccE2 (should restore function if effects are direct)

    • Point mutations versus domain deletions (finer mapping of functional regions)

    • Temporal analysis of effects (immediate effects more likely to be direct)

    • Structural context interpretation (mapping mutations onto predicted structures)

  • Analytical approaches:

    • Use randomized controlled trial designs when possible

    • Implement matched pairs design for comparing mutant vs. wild-type

    • Control for confounding variables in experimental setup

    • Use multiple independent assays to measure different aspects of function

  • Statistical considerations:

    • Ensure adequate sample sizes for statistical power

    • Apply appropriate statistical tests with correction for multiple comparisons

    • Report effect sizes along with p-values

    • Consider implementing randomized block designs to control for batch effects

What statistical approaches are most appropriate for analyzing protein-protein interaction data involving EccE2?

When analyzing protein-protein interaction data for EccE2:

  • For co-immunoprecipitation and pull-down experiments:

    • t-tests or ANOVA for comparing band intensities across conditions

    • Non-parametric alternatives if normality assumptions are violated

    • Include appropriate controls for non-specific binding

  • For biophysical interaction data (SPR, ITC):

    • Non-linear regression for fitting binding curves

    • Model comparison using Akaike Information Criterion

    • Bootstrap approaches to estimate confidence intervals

  • Experimental design considerations:

    • Use completely randomized designs where possible

    • Include positive and negative controls in each experiment

    • Perform power analysis to determine adequate sample size

    • Consider blocking factors in randomized block designs

Analysis TypeRecommended Statistical ApproachMinimum ReplicatesKey Controls
Co-IP quantificationANOVA with Tukey's post-hocn ≥ 3 biologicalIgG control, unrelated protein
Binding affinityNon-linear regressionn ≥ 3 technicalNon-binding mutant
Interaction networkPermutation-based significancen/aRandomized networks

How should researchers interpret conflicting data about EccE2 functionality across different mycobacterial species?

When faced with conflicting data across species:

  • Systematic evaluation approach:

    • Examine methodological differences between studies

    • Consider evolutionary differences in ESX-2 components across species

    • Evaluate genomic context and potential compensatory mechanisms

    • Directly compare protein sequences to identify key differences

  • Resolution strategies:

    • Perform direct comparative studies under identical conditions

    • Use complementation experiments across species

    • Investigate species-specific regulatory mechanisms

    • Consider differential interaction partners between species

  • Analysis framework:

    • Create a comparative table of results across species

    • Identify patterns in discrepancies (consistent vs. random)

    • Apply meta-analysis techniques when multiple studies exist

    • Evaluate study quality using established research quality criteria

What are the key considerations when comparing in vitro and in vivo data related to EccE2 function?

When reconciling in vitro and in vivo findings:

  • System differences to consider:

    • Detergent effects on membrane protein function in vitro

    • Presence of complete ESX-2 complex in vivo

    • Host environmental factors (pH, immune components)

    • Expression levels compared to physiological conditions

  • Integration strategies:

    • Design in vitro experiments to mimic physiological conditions

    • Validate in vitro findings with targeted in vivo experiments

    • Use reconstitution systems (liposomes, nanodiscs) as intermediate models

    • Apply computational modeling to bridge gaps between systems

  • Experimental design considerations:

    • Implement randomized controlled designs in both systems

    • Match conditions where possible (temperature, pH, ion concentrations)

    • Include appropriate system-specific controls

    • Consider matched pairs design when comparing systems directly

What emerging technologies hold promise for advancing our understanding of EccE2 structure and function?

Several cutting-edge technologies are poised to advance EccE2 research:

  • Structural biology approaches:

    • Cryo-electron microscopy for high-resolution structures, as used for related secretion system components

    • Integrative structural biology combining multiple experimental datasets

    • Advanced computational modeling (AlphaFold2) for structure prediction

  • Functional genomics:

    • CRISPR interference for targeted gene modulation

    • High-throughput mutagenesis coupled with deep sequencing

    • Conditional degradation systems for temporal control

  • Single-molecule techniques:

    • Single-molecule FRET to observe conformational changes

    • Nanopore recording of protein translocation events

    • Super-resolution microscopy for in situ visualization

  • Experimental design considerations:

    • Apply randomized controlled trial principles to new technology implementation

    • Establish appropriate controls for each new methodology

    • Consider potential biases introduced by new technologies

How might our understanding of EccE2 inform new therapeutic approaches for mycobacterial infections?

Translational implications of EccE2 research include:

  • Potential therapeutic strategies:

    • Small molecule inhibitors targeting EccE2 or critical interactions

    • Peptide-based inhibitors mimicking interaction interfaces

    • Structure-based vaccine design targeting exposed epitopes

  • Research approaches to therapeutic development:

    • Virtual screening against EccE2 structural models

    • Fragment-based drug discovery

    • High-throughput screening of compound libraries

    • Rational design based on interaction interfaces

  • Evaluation frameworks:

    • In vitro activity assessment (binding, secretion inhibition)

    • Cellular infection models

    • Animal models of infection

    • Resistance development studies

  • Experimental design considerations:

    • Implement randomized controlled trials for therapeutic testing

    • Include appropriate positive controls (established antibiotics)

    • Design studies with adequate statistical power

    • Consider matched pairs design for comparing treatment efficacy

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.