Recombinant ESX-3 secretion system protein eccB3 (eccB3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-538
Protein Length
full length protein
Target Names
eccB3
Target Protein Sequence
MTNQQHDHDFDHDRRSFASRTPVNNNPDKVVYRRGFVTRHQVTGWRFVMRRIAAGIALHD TRMLVDPLRTQSRAVLMGVLIVITGLIGSFVFSLIRPNGQAGSNAVLADRSTAALYVRVG EQLHPVLNLTSARLIVGRPVSPTTVKSTELDQFPRGNLIGIPGAPERMVQNTSTDANWTV CDGLNAPSRGGADGVGVTVIAGPLEDTGARAAALGPGQAVLVDSGAGTWLLWDGKRSPID LADHAVTSGLGLGADVPAPRIIASGLFNAIPEAPPLTAPIIPDAGNPASFGVPAPIGAVV SSYALKDSGKTISDTVQYYAVLPDGLQQISPVLAAILRNNNSYGLQQPPRLGADEVAKLP VSRVLDTRRYPSEPVSLVDVTRDPVTCAYWSKPVGAATSSLTLLAGSALPVPDAVHTVEL VGAGNGGVATRVALAAGTGYFTQTVGGGPDAPGAGSLFWVSDTGVRYGIDNEPQGVAGGG KAVEALGLNPPPVPIPWSVLSLFVPGPTLSRADALLAHDTLVPDSRPARPVSAEGGYR
Uniprot No.

Q&A

What is EccB3 and what is its role in the ESX-3 secretion system?

EccB3 is one of the core structural components of the ESX-3 secretion system in mycobacteria. It has a critical role in stabilizing the dimeric structure of the ESX-3 complex through extensive cross-protomer interactions. The protein begins in the cytoplasm with a flexible N-terminal tail, continues with a linker helix and a single-pass transmembrane domain, and extends into the periplasm with a large domain. The periplasmic domains of EccB3 proteins from adjacent protomers share a large interaction interface that further stabilizes dimerization of the complex . These interactions are essential for proper assembly and function of the secretion system that transports folded protein dimers across the complex cell wall of mycobacteria.

How is the structure of EccB3 determined experimentally?

The structure of EccB3 within the ESX-3 complex has been determined using cryo-electron microscopy (cryo-EM). This methodology involves:

  • Genetic modification of Mycobacterium smegmatis to incorporate epitope tags (e.g., cleavable EGFP tag inserted at the C-terminus of EccE3) using recombineering methods such as ORBIT (Oligonucleotide-mediated Recombineering followed by Bxb1 Integrase Targeting)

  • Expression enhancement through genetic manipulation (e.g., deletion of ideR to increase ESX-3 expression levels)

  • Protein complex purification using affinity chromatography with anti-GFP nanobodies

  • Size exclusion chromatography to isolate the intact complex

  • Cryo-EM imaging of the purified complex

  • Computational image processing and 3D reconstruction

  • Model building and refinement to generate the final structural model

This approach has revealed that EccB3 forms extensive interactions with multiple proteins in the ESX-3 complex and plays a crucial role in complex stabilization .

What purification strategies are most effective for recombinant EccB3?

The most effective purification strategies for recombinant EccB3 involve:

Chromosomal tagging approach:

  • Insertion of purification tags (like cleavable EGFP) directly into the chromosome of mycobacteria at the C-terminus of proteins in the ESX-3 operon (such as EccE3)

  • Use of the ORBIT method (Oligonucleotide-mediated Recombineering followed by Bxb1 Integrase Targeting) to create stable tagged strains

  • Growth in ideR deletion background to enhance expression of the ESX-3 operon

  • Cell lysis under conditions that preserve protein-protein interactions

  • Affinity purification using anti-GFP nanobodies

  • Proteolytic cleavage of the tag

  • Size exclusion chromatography to isolate intact complexes

This approach allows for purification of the entire ESX-3 complex with native stoichiometry and posttranslational modifications, avoiding potential artifacts from overexpression systems.

How does EccB3 interact with other components of the ESX-3 complex?

EccB3 forms extensive interactions with multiple components of the ESX-3 system:

EccB3 DomainInteraction PartnersNature of Interaction
N-terminal tailEccB3, EccC3, EccD3-bent and EccD3-extended from opposite protomerCross-protomer contacts stabilizing dimerization
Linker helixEccC3, EccD3-bentProtein-protein interactions within the same protomer
Transmembrane helixTransmembrane helix 11 of EccD3-extendedMembrane-embedded interaction
Transmembrane regionTransmembrane helix 2 of EccC3Connected by hydrophobic tails (possibly lipid or detergent molecules)
Periplasmic domainPeriplasmic domain of EccB3 from opposite protomerLarge interaction interface that further stabilizes dimerization

These interactions create a stable dimeric complex that forms the foundation for ESX-3 function, with EccB3 serving as a critical structural component bridging both protomers .

What is the role of EccB3 in potential higher-order oligomerization of ESX-3?

The ESX-3 complex appears to form dimers that may further assemble into higher-order oligomers, possibly hexamers (trimers of dimers). EccB3 plays a critical role in this process:

  • EccB3 forms the majority of cross-protomer interactions that stabilize the dimer, suggesting the periplasmic domain is essential for oligomerization

  • The EccB3 periplasmic domain shares structural homology with the peptidoglycan-binding phage protein PlyCB, which forms ring structures inside bacterial cell walls

  • Modeling suggests that in a hexameric assembly (trimer of dimers), the angle between protomers alternates between 72° (the angle between protomers i and ii in the ESX-3 dimer) and 48°

  • The periplasmic domain of EccB3 may serve as an anchor point to a larger outer membrane complex that was not captured in current purification approaches

To investigate this higher-order assembly, researchers could employ:

  • Cross-linking mass spectrometry to identify protein-protein interfaces

  • In situ cryo-electron tomography to visualize the native complex in the cellular environment

  • Site-directed mutagenesis of key residues in the periplasmic domain followed by functional assays

  • Native mass spectrometry to determine the stoichiometry of the complete complex

How can deep mutational scanning be applied to study EccB3 function?

Deep mutational scanning of EccB3 would provide comprehensive insights into structure-function relationships. Based on the recent approach used for EccD3 , a protocol for EccB3 would involve:

  • Library creation:

    • Systematic generation of single amino acid substitutions across EccB3, particularly focusing on:

      • The N-terminal cytoplasmic tail

      • The linker helix region

      • The transmembrane helix

      • Key residues in the periplasmic domain involved in dimerization

  • Functional selection:

    • Introduction of the mutant library into an EccB3-deletion strain of M. smegmatis

    • Growth under conditions requiring ESX-3 function (e.g., iron-limited media)

    • Parallel growth in permissive conditions as a control for expression effects

  • Sequencing and analysis:

    • Deep sequencing before and after selection to determine enrichment/depletion of each variant

    • Calculation of fitness scores for each amino acid substitution

    • Mapping of fitness effects onto the protein structure

  • Validation:

    • Individual testing of key mutations identified in the screen

    • Functional assays measuring protein secretion, complex formation, and metal uptake

    • Structural analysis of selected mutants to determine mechanistic effects

This approach would generate a comprehensive mutational landscape of EccB3, revealing residues critical for assembly, stability, and function of the ESX-3 complex .

How do the structural properties of EccB3 compare across different mycobacterial ESX systems?

EccB proteins are found in all ESX systems (ESX-1 through ESX-5) in mycobacteria. A comparative analysis reveals:

Understanding these comparative aspects is critical for developing system-specific inhibitors and for engineering ESX systems for biotechnological applications.

What methods can be used to study EccB3 dynamics during the secretion process?

Studying the dynamic behavior of EccB3 during active secretion requires specialized approaches:

  • Time-resolved structural methods:

    • Single-particle cryo-EM with substrate trapped at different stages of transport

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions with altered solvent accessibility during secretion

    • FRET-based sensors inserted at key positions to monitor conformational changes

  • Computational approaches:

    • Molecular dynamics simulations of the ESX-3 complex with and without bound substrate

    • Normal mode analysis to identify potential conformational changes during the transport cycle

    • Coarse-grained modeling to simulate large-scale movements over longer timescales

  • Functional assays:

    • Site-specific crosslinking to capture transient interactions during secretion

    • In vitro reconstitution of the secretion process with purified components

    • Real-time fluorescence-based secretion assays with labeled substrates

  • Genetic approaches:

    • Creation of conditional mutations that block secretion at different stages

    • Suppressor screens to identify functional interactions

    • Epistasis analysis between EccB3 mutations and mutations in other components

These approaches would provide insights into how EccB3 participates in the dynamic process of substrate recognition, engagement, and translocation through the ESX-3 system.

What are the potential druggable sites in EccB3 that could be targeted for tuberculosis treatment?

Given the essential nature of ESX-3 for mycobacterial survival, particularly for iron and zinc homeostasis in M. tuberculosis, EccB3 represents a promising drug target. Key potential druggable sites include:

  • Interface regions critical for dimerization:

    • The extensive cross-protomer interaction interface in the periplasmic domain

    • The N-terminal tail interactions with components of the opposite protomer

    • Compounds disrupting these interfaces could destabilize the entire complex

  • Membrane-spanning regions:

    • The single transmembrane helix and its interactions with EccD3

    • The hydrophobic connections to EccC3's transmembrane domain

    • Small molecules that disrupt these interactions could affect complex integrity

  • Potential functional sites:

    • The periplasmic domain that may interact with the cell wall or outer membrane components

    • Regions involved in potential conformational changes during the secretion cycle

  • Target validation approaches:

    • Structure-based drug design utilizing the cryo-EM structures

    • Fragment-based screening against purified EccB3

    • Peptidomimetic inhibitors designed to disrupt protein-protein interactions

    • Deep mutational scanning data to identify critical residues for targeting

The high degree of conservation of ESX components among mycobacterial species makes EccB3 an attractive target for broad-spectrum antimycobacterial drugs, while system-specific variations could potentially allow for selective targeting of pathogenic species.

How can one design a recombinant EccB3 construct that maintains native function?

Designing functional recombinant EccB3 constructs requires careful consideration of structural and functional constraints:

  • Expression system considerations:

    • Native host (M. smegmatis or M. tuberculosis) expression provides the most authentic environment

    • Chromosomal integration using recombineering approaches (e.g., ORBIT method) maintains native regulation

    • Expression levels should be kept close to physiological to avoid artifacts from overexpression

  • Tag placement optimization:

    • C-terminal tags are preferred as the N-terminus is involved in critical protein-protein interactions

    • Use of small, cleavable tags (e.g., His-tag with TEV cleavage site) to minimize functional interference

    • Consider internal tags at permissive sites determined by structural analysis

  • Construct design guidelines:

    • Include the entire coding sequence to preserve all functional domains

    • Consider co-expression with interacting partners (e.g., other ESX-3 components) to maintain stability

    • For difficult regions, utilize structure-guided protein engineering to improve stability

  • Validation experiments:

    • Complementation assays in eccB3 deletion strains under conditions requiring ESX-3 function

    • Verification of complex formation by co-immunoprecipitation

    • Structural analysis (e.g., cryo-EM) to confirm proper folding and assembly

    • Functional secretion assays measuring transport of known ESX-3 substrates

This approach ensures that recombinant EccB3 retains its native structure and function for reliable experimental studies.

What are the challenges in studying EccB3 interactions with the mycobacterial cell wall?

Studying EccB3 interactions with the complex mycobacterial cell wall presents several unique challenges and requires specialized approaches:

  • Technical challenges:

    • The mycobacterial cell wall contains unique components (mycolic acids, arabinogalactan) not found in model expression systems

    • The periplasmic domain of EccB3 may interact with components not captured in current purification protocols

    • Similarity to peptidoglycan-binding proteins suggests potential cell wall interactions

  • Methodological approaches:

    • In situ crosslinking using photoactivatable amino acids incorporated at specific positions in EccB3

    • Cell wall fractionation followed by pull-down assays to identify interacting components

    • Fluorescence microscopy with site-specifically labeled EccB3 to track localization relative to cell wall markers

    • Atomic force microscopy of purified EccB3 periplasmic domain interacting with isolated cell wall components

  • Reconstitution systems:

    • Development of artificial membrane systems incorporating mycobacterial cell wall components

    • Co-purification of native cell wall fragments with the ESX-3 complex

    • Nanodiscs or liposomes containing relevant lipids and cell wall precursors

  • Genetic approaches:

    • Systematic mutation of residues in the periplasmic domain followed by functional assays

    • Suppressor screens to identify genetic interactions with cell wall biosynthesis genes

    • Conditional depletion of specific cell wall components to assess effects on EccB3 function

These approaches would help elucidate how EccB3 interacts with the complex cell envelope of mycobacteria, potentially revealing new aspects of ESX-3 function and regulation.

How can cryo-EM data of EccB3 be optimally processed and analyzed?

Optimal processing and analysis of cryo-EM data for EccB3 as part of the ESX-3 complex involves several specialized steps:

  • Data collection optimization:

    • Use of energy filters and direct electron detectors to maximize signal-to-noise ratio

    • Collection of movie frames to allow for motion correction

    • Appropriate defocus range selection to capture high-resolution features

  • Image processing workflow:

    • Motion correction using algorithms like MotionCor2

    • CTF estimation with programs such as CTFFIND4

    • Particle picking strategies (template-based or deep learning approaches)

    • 2D and 3D classification to separate heterogeneous populations

    • 3D refinement with appropriate symmetry considerations

    • Post-processing including B-factor sharpening and local resolution estimation

  • Model building considerations specific to EccB3:

    • De novo building for regions with high-resolution density

    • Homology modeling based on available structures of related proteins

    • Integrative modeling incorporating crosslinking or other experimental constraints

    • Special attention to the flexible N-terminal tail and periplasmic domain

  • Validation approaches:

    • Resolution assessment using gold-standard FSC criteria

    • Model-to-map correlation analysis

    • Structure validation using MolProbity and EMRinger

    • Cross-validation using independent datasets

  • Analysis of conformational heterogeneity:

    • 3D variability analysis or focused classification to identify conformational states

    • Multibody refinement to characterize domain movements

    • Classification strategies to identify potential substrate-bound states

This comprehensive approach maximizes information extraction from cryo-EM data, providing high-quality structural information about EccB3 and its interactions within the ESX-3 complex .

How should researchers interpret contradictory findings about EccB3 function?

When faced with contradictory findings about EccB3 function, researchers should employ a systematic approach to resolve discrepancies:

  • Contextual factors to consider:

    • Experimental system differences (organism, strain background, growth conditions)

    • Methodological variations (purification approaches, tags, assay conditions)

    • Analysis of native versus recombinant systems

    • The potential impact of membrane environment on protein function

  • Systematic resolution approach:

    • Direct side-by-side comparison using standardized protocols

    • Orthogonal methods to validate key findings

    • Control experiments to identify potential artifacts

    • Collaborative cross-laboratory validation studies

  • Specific case examples:

    • Oligomeric state discrepancies: ESX systems have been reported as dimers, hexamers, or higher-order oligomers . These differences may reflect:

      • Different purification conditions affecting complex stability

      • Genuine biological heterogeneity in complex assembly

      • Technical limitations of different structural methods

    • Functional role contradictions: EccB3 has been suggested to have both structural and active roles in secretion. These could be reconciled by:

      • Considering dual functions in different contexts

      • Temporal changes in function during the secretion cycle

      • Species-specific adaptations in different mycobacteria

  • Integration framework:

    • Development of unifying models that accommodate seemingly contradictory data

    • Identification of testable hypotheses to discriminate between competing models

    • Computational approaches to simulate different scenarios and compare with experimental data

This structured approach allows researchers to navigate contradictory findings and develop a more comprehensive understanding of EccB3 function within the ESX-3 system.

How can structural knowledge of EccB3 guide the development of new tuberculosis therapeutics?

Structural insights into EccB3 can drive therapeutic development through multiple approaches:

  • Structure-based drug design strategies:

    • Virtual screening of compound libraries against identified druggable pockets

    • Fragment-based approaches targeting interface regions critical for complex assembly

    • Design of peptidomimetics that disrupt essential protein-protein interactions

    • Development of allosteric modulators that lock EccB3 in non-functional conformations

  • Key target sites identified from structural analysis:

    • The cross-protomer interaction interface formed by EccB3 periplasmic domains

    • N-terminal tail interactions that stabilize the ESX-3 dimer

    • Transmembrane interactions with other complex components

    • Potential cell wall binding sites in the periplasmic domain

  • Rational drug design workflow:

    • Identification of essential residues using deep mutational scanning data

    • In silico screening against identified pockets

    • Biochemical validation of hit compounds using purified components

    • Cellular assays in mycobacterial systems

    • Structure-activity relationship studies to optimize lead compounds

    • In vivo validation in infection models

  • Innovative therapeutic approaches:

    • Targeted protein degradation strategies directed at EccB3

    • Interfering antibodies or nanobodies that bind to accessible epitopes

    • PROTAC-like molecules to induce degradation of ESX-3 components

    • RNA-based therapeutics to reduce expression of essential components

This structure-guided approach could lead to novel anti-tuberculosis agents with mechanisms distinct from current therapeutics, addressing the critical need for new treatment options against drug-resistant strains.

What research tools can be developed based on EccB3 to study mycobacterial secretion systems?

EccB3 can serve as the foundation for developing specialized research tools to study mycobacterial secretion:

  • Protein-based tools:

    • Purified periplasmic domain as a probe for cell wall interactions

    • Fluorescently labeled EccB3 variants for localization studies

    • Conformation-specific antibodies to track structural changes during secretion

    • Engineered EccB3 variants with introduced disulfide bonds to lock specific conformations

  • Genetic tools:

    • Reporter fusion constructs to monitor EccB3 expression and localization

    • Bacterial two-hybrid systems optimized for mycobacterial membrane proteins

    • Conditional expression systems to regulate EccB3 levels

    • CRISPR interference systems for targeted knockdown

  • Biochemical and structural tools:

    • Reconstituted proteoliposomes containing defined ESX-3 components

    • Native mass spectrometry protocols optimized for ESX complexes

    • Cross-linking mass spectrometry workflows to capture interaction networks

    • In vitro secretion assays using purified components

  • Computational resources:

    • Molecular dynamics simulation packages parameterized for ESX components

    • Sequence analysis tools to predict functional regions across ESX systems

    • Structural databases of ESX component models across mycobacterial species

    • Machine learning approaches to predict functional consequences of mutations

These tools would significantly advance research into mycobacterial secretion systems, enabling more detailed mechanistic studies and potentially revealing new aspects of ESX function that could be exploited for therapeutic development.

What are the most promising approaches for studying dynamic changes in EccB3 during substrate transport?

Understanding the dynamic behavior of EccB3 during substrate transport requires innovative approaches:

  • Advanced structural methods:

    • Time-resolved cryo-EM using microfluidic devices to capture transient states

    • Single-molecule FRET studies with strategically placed fluorophores to monitor conformational changes

    • Hydrogen-deuterium exchange mass spectrometry to identify regions with altered dynamics

    • EPR spectroscopy with site-directed spin labeling to measure distances between domains

  • Integrated experimental-computational approaches:

    • Molecular dynamics flexible fitting (MDFF) to interpret intermediate resolution maps

    • Enhanced sampling techniques to model large-scale conformational changes

    • Machine learning approaches to predict dynamic motions from static structures

    • Coarse-grained simulations to reach biologically relevant timescales

  • Functional trapping strategies:

    • Engineering stalled transport intermediates through substrate modifications

    • Temperature-sensitive mutations that arrest the transport cycle at specific steps

    • Photo-activatable crosslinkers positioned at strategic sites

    • Small-molecule inhibitors that block specific steps in the transport process

  • In vivo imaging approaches:

    • Super-resolution microscopy of fluorescently tagged EccB3 during active secretion

    • Correlative light and electron microscopy to connect function with structure

    • Live-cell single-molecule tracking to monitor complex assembly and dynamics

    • Expansion microscopy to visualize nanoscale arrangements of ESX-3 components

These complementary approaches would provide unprecedented insights into how EccB3 and the ESX-3 complex function as a dynamic molecular machine during the substrate transport process.

How can systems biology approaches enhance our understanding of EccB3 in the context of mycobacterial physiology?

Systems biology offers powerful frameworks for understanding EccB3 function within the broader context of mycobacterial physiology:

  • Multi-omics integration approaches:

    • Proteomics to identify changes in protein-protein interactions under different conditions

    • Transcriptomics to map co-expression networks related to ESX-3 function

    • Metabolomics to connect ESX-3 activity with changes in iron/zinc homeostasis

    • Lipidomics to identify changes in membrane composition affecting ESX-3 function

  • Network analysis methods:

    • Protein-protein interaction networks centered on ESX-3 components

    • Genetic interaction mapping using synthetic genetic arrays

    • Pathway enrichment analysis to identify processes connected to ESX-3 function

    • Network perturbation analysis to predict system-wide effects of EccB3 inhibition

  • Mathematical modeling approaches:

    • Kinetic models of ESX-3 transport mechanisms

    • Whole-cell models incorporating ESX-3 function in iron/zinc homeostasis

    • Agent-based modeling of ESX complex assembly and dynamics

    • Constraint-based metabolic models to predict phenotypic consequences of ESX-3 disruption

  • Integrative experimental designs:

    • Multiplexed CRISPR screens to identify genetic interactions

    • Time-course experiments capturing dynamic responses to environmental changes

    • Microfluidic single-cell analysis to characterize population heterogeneity

    • Dual RNA-seq approaches to simultaneously monitor host and pathogen during infection

These systems-level approaches would place EccB3 function in the broader context of mycobacterial physiology, revealing both direct mechanisms and emergent properties that could inform new therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.