Recombinant ESX-3 secretion system protein EccE3 (eccE3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Target Names
eccE3
Target Protein Sequence
MNPIPSWPGRGRVTLVLLAVVPVALAYPWQSTRDYVLLGVAAAVVIGLFGFWRGLYFTTI ARRGLAILRRRRRIAEPATCTRTTVLVWVGPPASDTNVLPLTLIARYLDRYGIRADTIRI TSRVTASGDCRTWVGLTVVADDNLAALQARSARIPLQETAQVAARRLADHLREIGWEAGT AAPDEIPALVAADSRETWRGMRHTDSDYVAAYRVSANAELPDTLPAIRSRPAQETWIALE IAYAAGSSTRYTVAAACALRTDWRPGGTAPVAGLLPQHGNHVPALTALDPRSTRRLDGHT DAPADLLTRLHWPTPTAGAHRAPLTNAVSRT
Uniprot No.

Q&A

What is the structural organization of the EccE3 protein within the ESX-3 secretion system?

EccE3 is positioned at the front of the ESX-3 dimer with a distinct architecture that includes two transmembrane helices. The first conserved transmembrane helix (TM1) interacts directly with helix 11 of EccD3-bent within the membrane environment. Following TM1, EccE3 contains a second transmembrane helix, a linker helix, and then extends into the cytoplasmic space. The cytoplasmic domain of EccE3 features anti-parallel β-sheets that exhibit weak structural homology to glycosyl transferase proteins, although it notably lacks a nucleotide binding pocket, rendering it incapable of nucleotide-binding functions .

The complete ESX-3 protomer complex incorporates a single copy each of EccB3, EccC3, and EccE3, along with two copies of the EccD3 protein in distinct conformational states (referred to as EccD3-bent and EccD3-extended). These components assemble into a stable dimeric structure that potentially serves as the building block for higher-order oligomers .

What is the genomic context of the eccE3 gene within mycobacteria?

EccE3 is positioned as the final gene in the 11-gene ESX-3 operon, which has significant implications for genetic manipulation. This terminal position makes insertional modifications at this site less likely to disrupt the regulation and expression of upstream genes within the operon. The ESX-3 operon encodes components critical for the Type VII secretion system, which facilitates the translocation of folded protein dimers belonging to the WXG100-superfamily across the cytoplasmic membrane .

What are the optimal strategies for recombinant expression of EccE3 protein?

For recombinant expression of EccE3, researchers should consider the endogenous purification approach that has proven successful in previous studies. This method involves inserting an epitope tag directly into the chromosomal locus of the target organism, rather than plasmid-based expression systems. For example, successful structural studies of the ESX-3 complex utilized recombineering techniques to introduce an epitope tag into the chromosome of Mycobacterium smegmatis, which served as a model organism .

This approach offers several advantages:

  • Maintenance of native expression levels

  • Preservation of natural stoichiometry with partner proteins

  • Reduction of potential artifacts associated with overexpression

For membrane proteins like EccE3, maintaining the natural membrane environment during early purification steps is critical for structural integrity.

How can sample size calculations be optimized for experiments involving recombinant EccE3?

When designing experiments involving recombinant EccE3, researchers should employ rigorous sample size calculations to ensure statistical validity while minimizing resource usage. The Experimental Design Assistant (EDA) represents a valuable tool for this purpose, especially for complex biomolecular studies. In a survey of researchers using this approach, over 80% reported that the EDA methodology helped them develop a better understanding of appropriate sample sizing .

For EccE3 studies specifically, researchers should consider:

  • Statistical power requirements (typically 0.8 or higher)

  • Expected effect size based on preliminary data

  • Variability in protein expression and purification yields

  • Technical replication needs for structural or functional assays

This methodological approach is particularly important for in vivo experiments, where it can help ensure that studies are robust and meaningful while using the fewest number of animals needed to generate reliable results .

What cryo-electron microscopy techniques are most effective for studying the structure of recombinant EccE3 within the ESX-3 complex?

Cryo-electron microscopy (cryo-EM) has proven to be the most effective technique for elucidating the structure of EccE3 within the context of the complete ESX-3 complex. For optimal results, researchers should consider the following methodological approaches:

  • Sample preparation: Following affinity purification, the ESX-3 complex containing EccE3 should be purified as a large molecular weight species (approximately 900 kDa). This preparation typically yields a dimeric structure that can be visualized by cryo-EM .

  • Data collection strategy: Due to the inherent flexibility of certain regions within the ESX-3 complex, particularly the periplasmic multimerization domain and the lower cytoplasmic motor domain, researchers should employ a data collection strategy that accounts for structural heterogeneity. This may involve collecting a larger dataset than would typically be necessary for more rigid protein complexes .

  • Image processing: Advanced data processing techniques are essential to resolve the variable resolution observed in different parts of the electron microscopy map. Researchers have successfully employed focused refinement approaches to improve the resolution of specific domains within the complex .

The resolution achievable with these techniques can reach approximately 3.7 Å, allowing for de novo model building of the complex components, including EccE3 .

How does the deletion or mutation of EccE3 affect the functionality of the ESX-3 secretion system?

Key functional effects observed upon EccE3 deletion or mutation include:

  • Compromised assembly of the complete ESX-3 complex, with particular disruption to the dimeric architecture

  • Altered membrane localization of other ESX-3 components

  • Reduced secretion of WXG100-superfamily protein substrates

  • Potential metabolic dysregulation, particularly related to iron/zinc acquisition systems that depend on ESX-3 functionality

Methodologically, researchers investigating these effects should employ both biochemical assays (protein secretion quantification) and phenotypic assessments (growth under various nutrient-limiting conditions) to comprehensively characterize the impact of EccE3 modifications.

What is the role of EccE3 in protein substrate recognition and translocation?

Despite its structural similarity to glycosyl transferase proteins, EccE3 lacks a nucleotide binding pocket, suggesting a different functional role in the ESX-3 secretion process . Current evidence indicates that EccE3 primarily contributes to the structural organization of the secretion apparatus rather than directly participating in substrate recognition.

The positioning of EccE3 at the front of the ESX-3 dimer, where its transmembrane helix 1 interacts with helix 11 of EccD3-bent in the membrane, suggests a potential role in stabilizing the secretion channel architecture . This structural contribution may be essential for maintaining the proper conformation of the translocation pathway through which WXG100-superfamily protein dimers pass.

For researchers investigating this aspect, methodological approaches should include:

  • Site-directed mutagenesis of interface residues between EccE3 and other components

  • In vitro reconstitution of translocation using purified components

  • Substrate-binding assays to detect any direct interactions between EccE3 and secreted proteins

How does the oligomeric state of the ESX-3 complex influence EccE3 function?

While the primary structural unit of the ESX-3 complex containing EccE3 appears to be a dimer, examination of void volume fractions during purification has revealed a small number of particles in higher oligomeric states . This observation raises important questions about the functional significance of ESX-3 oligomerization.

Researchers investigating this aspect should consider:

  • The potential role of EccE3 in mediating interactions between individual ESX-3 dimers

  • Whether different oligomeric states correlate with distinct functional states of the secretion system

  • How environmental factors or substrate binding might influence the equilibrium between different oligomeric forms

Methodologically, this question could be addressed through:

  • Analytical ultracentrifugation with purified complexes

  • Chemical crosslinking followed by mass spectrometry

  • Single-molecule fluorescence microscopy to visualize oligomerization states in native membranes

  • Cryo-electron tomography to visualize the secretion system in situ

What are the challenges in designing inhibitors targeting EccE3 for therapeutic applications?

For researchers exploring the therapeutic potential of targeting EccE3, several methodological challenges must be addressed:

  • Specificity considerations: The structural homology between EccE3 and glycosyl transferase proteins, despite functional differences, presents challenges for inhibitor specificity. Researchers must develop assays capable of distinguishing between binding to EccE3 and potential off-target effects on functionally related proteins .

  • Membrane accessibility: The transmembrane localization of portions of EccE3 creates barriers for inhibitor access. Methodological approaches should include lipophilicity optimization and membrane permeability assessments for candidate compounds.

  • Functional validation: Since EccE3 appears to play a structural role rather than possessing enzymatic activity, traditional activity-based assays may not be applicable. Researchers should develop alternative methods to validate functional inhibition, such as:

    • Protein-protein interaction disruption assays

    • Secretion inhibition measurements

    • Structural perturbation detection methods

What are the best practices for purifying recombinant EccE3 for structural studies?

For optimal purification of recombinant EccE3 for structural analysis, researchers should follow these methodological guidelines based on successful approaches:

  • Expression system selection: The chromosome-based epitope tagging approach in model organisms such as Mycobacterium smegmatis has proven successful for maintaining native stoichiometry and interactions .

  • Purification strategy:

    • Affinity purification using the introduced epitope tag

    • Size exclusion chromatography to isolate the approximately 900 kDa complex

    • Careful assessment of void volume fractions that may contain higher-order oligomers

  • Sample quality assessment:

    • Negative stain electron microscopy as a preliminary evaluation

    • Mass spectrometry analysis to confirm complex composition

    • Thermal stability assays to optimize buffer conditions

  • Cryo-EM sample preparation:

    • Grid type and treatment optimization

    • Vitrification condition screening

    • Assessment of particle distribution and orientation diversity

These methods have enabled researchers to achieve reconstructions with resolution sufficient for de novo model building of EccE3 within the ESX-3 complex .

How can researchers effectively analyze the heterogeneity in ESX-3 complex structure?

The ESX-3 complex exhibits significant structural heterogeneity, particularly in the flexible periplasmic multimerization domain and the lower cytoplasmic motor domain . Researchers seeking to address this challenge should implement the following methodological approaches:

  • Data collection strategy:

    • Collect larger datasets to ensure sufficient representation of different conformational states

    • Optimize imaging parameters to enhance contrast for flexible regions

  • Computational analysis:

    • Apply 3D classification techniques to sort particles into homogeneous subsets

    • Implement focused refinement approaches for regions of interest

    • Utilize local resolution estimation to guide model building and interpretation

  • Validation methods:

    • Cross-validate structures using independent datasets

    • Compare with complementary structural techniques (e.g., crosslinking mass spectrometry)

    • Assess biological plausibility of identified conformational states

By addressing the inherent flexibility and heterogeneity of the ESX-3 complex, researchers can gain deeper insights into the dynamic structural transitions that might be essential for EccE3 function during the secretion process .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.