Recombinant Eucalyptus globulus subsp. globulus Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer specifications.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Eucalyptus globulus subsp. globulus (Tasmanian blue gum)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQVKQV LANGKRGGLNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQSYRPNKKNILVIGPVSG QKYSEVTFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGVVS KIIRKEKGGYEITISDASDERQVVDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPFRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its function in Eucalyptus globulus?

Apocytochrome f is the precursor form (without heme) of cytochrome f, a crucial component of the cytochrome b6f complex in the photosynthetic electron transport chain. In Eucalyptus globulus, the petA gene encodes this protein, which is essential for photosynthetic function. The mature protein spans amino acids 36-320 and contains characteristic domains for electron transport activity .

The protein functions primarily in electron transfer between Photosystem II and Photosystem I in the thylakoid membrane of chloroplasts. This electron transport is coupled to proton translocation across the membrane, which drives ATP synthesis. The complete chloroplast genome sequence of Eucalyptus globulus reveals that the petA gene is part of a genomic architecture that includes 128 genes (112 individual gene species and 16 genes duplicated in the inverted repeat) coding for 30 transfer RNAs, 4 ribosomal RNAs, and 78 proteins within a 160,286 bp genome .

How does the expression and processing of Apocytochrome f occur in chloroplasts?

The biosynthesis of cytochrome f is a multi-step process involving translation of the petA gene, processing of the precursor protein, and covalent attachment of heme. Based on studies in other plant species like Chlamydomonas reinhardtii (which provides insights applicable to Eucalyptus), the process typically occurs as follows:

  • The petA gene is transcribed and translated to produce pre-apocytochrome f with an N-terminal transit peptide.

  • The precursor protein is imported into the chloroplast and processed by a thylakoid processing peptidase that cleaves at a consensus site (often AQA).

  • Following processing, heme attachment occurs through the action of a heme lyase, which creates thioether bonds between the heme vinyl groups and cysteine residues in the protein.

  • One axial ligand of the c-heme is provided by the alpha-amino group of Tyr1 generated upon cleavage of the signal sequence from the precursor protein.

  • The mature protein, now holocytochrome f, is integrated into the cytochrome b6f complex in the thylakoid membrane .

Interestingly, research has shown that heme binding is not a prerequisite for cytochrome f processing, and the C-terminus membrane anchor appears to down-regulate the rate of synthesis of cytochrome f .

How does recombinant Eucalyptus globulus Apocytochrome f compare structurally and functionally to homologs in other plant species?

The Apocytochrome f protein from Eucalyptus globulus shows both conservation and divergence when compared to homologs in other plant species. A detailed comparison with cytochrome f from other species reveals:

SpeciesSequence Identity (%)Key Structural DifferencesFunctional Implications
Populus trichocarpa~85-90%Minor variations in loop regionsSimilar electron transport kinetics
Nicotiana tabacum~80-85%Different surface residuesSlightly altered redox potential
Chlamydomonas reinhardtii~65-70%More significant variations in non-conserved regionsDifferent interaction with plastocyanin
Arabidopsis thaliana~80-85%Similar core structureComparable activity in reconstitution assays

The chloroplast genome of Eucalyptus globulus is essentially co-linear with that of another hardwood tree species, Populus trichocarpa, with some notable differences. For instance, Populus lacks rps16 and rpl32, and the inverted repeat has expanded in Populus to include rps19 (which is part of the LSC in E. globulus) . These genomic differences may have subtle effects on gene expression patterns and regulatory mechanisms, though the core function of cytochrome f remains conserved.

What are the challenges in expressing and purifying functional recombinant Eucalyptus globulus Apocytochrome f?

Expressing and purifying functional recombinant Apocytochrome f from Eucalyptus globulus presents several challenges that researchers must address:

  • Expression system selection: While E. coli is commonly used for recombinant protein expression (as indicated in search result ), it lacks the machinery for proper heme attachment, often resulting in expression of the apoprotein rather than the holoprotein.

  • Protein folding and stability: The protein contains multiple domains that must fold correctly for function. Misfolded proteins are typically degraded by proteolytic systems associated with cell membranes .

  • Heme incorporation: For functional studies, heme must be incorporated either during expression (requiring specialized expression systems) or through in vitro reconstitution.

  • Membrane association: The native protein has a C-terminal membrane anchor that can complicate purification. Truncated versions lacking this anchor may be easier to purify but might have altered properties.

  • Storage stability: The purified protein requires specific storage conditions (typically -20°C/-80°C) and may be sensitive to repeated freeze-thaw cycles .

To overcome these challenges, researchers should consider:

  • Using specialized E. coli strains co-expressing heme lyases

  • Adding exogenous heme during expression

  • Including stabilizing agents like glycerol (typically 50%) in storage buffers

  • Utilizing a His-tag for affinity purification followed by size exclusion chromatography

  • Reconstituting the purified apoprotein with heme in vitro under controlled conditions

How do mutations in the petA gene affect cytochrome f structure and function?

Mutations in the petA gene can significantly impact cytochrome f structure and function, with consequences for photosynthetic efficiency. Based on site-directed mutagenesis studies (primarily in model organisms like Chlamydomonas reinhardtii, but applicable to understanding Eucalyptus cytochrome f):

  • Heme-binding site mutations: Substitution of the cysteinyl residues responsible for covalent ligation of the c-heme (with valine and leucine) prevents heme attachment but does not prevent protein processing .

  • Processing site mutations: Replacing the consensus cleavage site for the thylakoid processing peptidase (AQA) with an LQL sequence results in delayed processing but does not prevent heme binding. The resulting transformants are typically nonphototrophic .

  • Membrane anchor modifications: Alterations to the C-terminal membrane anchor affect protein synthesis rates and integration into the thylakoid membrane .

  • Electron transfer domain mutations: Changes to residues involved in electron transfer can alter redox potential and electron transfer kinetics.

These findings suggest that pre-apocytochrome f adopts a suitable conformation for the cysteinyl residues to be substrates of the heme lyase even without normal processing, and pre-holocytochrome f can fold in an assembly-competent conformation despite processing defects .

What are the optimal conditions for expressing recombinant Eucalyptus globulus Apocytochrome f in E. coli?

Optimal expression of recombinant Eucalyptus globulus Apocytochrome f in E. coli requires careful consideration of multiple parameters. Based on established protocols for similar proteins and the specific information available for this protein :

ParameterOptimal ConditionNotes
E. coli strainBL21(DE3) or Rosetta(DE3)Rosetta strains provide rare codons that may improve expression
Expression vectorpET series with T7 promoterShould include N-terminal His-tag for purification
Induction temperature16-20°CLower temperatures improve proper folding
IPTG concentration0.1-0.5 mMLower concentrations may improve solubility
Induction time16-20 hoursExtended time at lower temperature
Media supplements5-aminolevulinic acid (ALA)Precursor for heme biosynthesis
Media compositionTerrific Broth or 2xYTRich media improves yield
Extraction bufferTris-based, pH 8.0Should include protease inhibitors

The expression construct should focus on the mature protein domain (amino acids 36-320) , excluding the chloroplast transit peptide and potentially the C-terminal membrane anchor for improved solubility. For functional studies requiring heme incorporation, co-expression with a suitable heme lyase or in vitro reconstitution with heme post-purification may be necessary.

How can researchers assess the structural integrity and functionality of purified recombinant Apocytochrome f?

Assessing the structural integrity and functionality of purified recombinant Apocytochrome f requires multiple complementary techniques:

  • Spectroscopic analysis:

    • UV-visible spectroscopy to confirm heme incorporation (characteristic peaks at ~410 nm for the Soret band and ~530 and ~560 nm for α and β bands)

    • Circular dichroism (CD) to assess secondary structure content

    • Fluorescence spectroscopy to evaluate tertiary structure

  • Biochemical assays:

    • Heme content quantification using the pyridine hemochromogen assay

    • Redox potential determination using potentiometric titration

    • Electron transfer kinetics using stopped-flow spectroscopy with electron donors/acceptors

  • Structural analysis:

    • Size exclusion chromatography to assess oligomeric state and hydrodynamic properties

    • Limited proteolysis to probe protein folding and domain organization

    • Thermal shift assays to evaluate stability

  • Functional reconstitution:

    • Integration into liposomes or nanodiscs

    • Reconstitution with other components of the cytochrome b6f complex

    • Electron transfer assays using artificial electron donors and acceptors

  • Interaction studies:

    • Surface plasmon resonance (SPR) or microscale thermophoresis (MST) to measure binding to plastocyanin or other interaction partners

    • Co-immunoprecipitation with partner proteins

These methods collectively provide a comprehensive assessment of whether the recombinant protein is properly folded and functionally active.

What approaches can be used to study the interaction of Apocytochrome f with other components of the photosynthetic electron transport chain?

Studying the interactions between Apocytochrome f and other components of the photosynthetic electron transport chain requires specialized techniques that can detect transient protein-protein interactions in membrane environments:

  • In vitro reconstitution systems:

    • Reconstitution of purified cytochrome f with other purified components (cytochrome b6, subunit IV, etc.) in liposomes or nanodiscs

    • Measurement of electron transfer rates in the reconstituted system

    • Assessment of complex formation using blue native PAGE or analytical ultracentrifugation

  • Cross-linking approaches:

    • Chemical cross-linking followed by mass spectrometry (XL-MS) to identify interaction interfaces

    • Site-specific photocrosslinking using unnatural amino acids

    • In vivo crosslinking followed by co-immunoprecipitation

  • Biophysical interaction analyses:

    • Surface plasmon resonance (SPR) with immobilized cytochrome f

    • Isothermal titration calorimetry (ITC) to determine binding thermodynamics

    • Förster resonance energy transfer (FRET) between labeled proteins

  • Computational approaches:

    • Molecular docking simulations based on known structures

    • Molecular dynamics simulations of the cytochrome b6f complex

    • Coevolution analysis to identify potentially interacting residues

  • Genetic approaches:

    • Yeast two-hybrid or split-ubiquitin assays for membrane protein interactions

    • Suppressor mutation analysis to identify functional interactions

These approaches can provide insights into how Eucalyptus globulus Apocytochrome f interacts with its partners and how these interactions compare with those in other plant species.

How should researchers interpret spectroscopic data from recombinant Apocytochrome f versus holocytochrome f?

Interpreting spectroscopic data from recombinant Apocytochrome f versus holocytochrome f requires careful consideration of the distinct spectral features associated with each form:

Spectroscopic TechniqueApocytochrome fHolocytochrome fInterpretation Guidelines
UV-visible spectroscopyProtein absorbance at 280 nm onlyStrong Soret band at ~410 nm; α and β bands at ~550-560 nmThe ratio of Soret to 280 nm absorbance indicates heme incorporation efficiency
Circular dichroism (CD)Secondary structure features onlyAdditional signals from heme environmentChanges in CD spectra upon heme binding indicate structural reorganization
Fluorescence spectroscopyStrong tryptophan/tyrosine fluorescenceQuenched fluorescence due to energy transfer to hemeDegree of quenching correlates with heme incorporation efficiency
Resonance RamanProtein vibrational modes onlyAdditional bands from heme and its protein ligandsShifts in heme-related bands indicate changes in heme environment

Key considerations for data interpretation:

  • Apocytochrome f (without heme) should show typical protein spectra without the characteristic heme-associated features.

  • Partially reconstituted samples will show a mixture of features, requiring deconvolution to determine the ratio of apo to holo forms.

  • The native holoprotein should have a characteristic absorbance ratio (A410/A280) that can be used as a benchmark for reconstitution efficiency.

  • Reduction with dithionite should produce characteristic shifts in the spectra of holocytochrome f, with the α and β bands becoming more pronounced and shifting slightly.

  • The absence of expected spectral changes upon reduction may indicate improper heme coordination or protein misfolding.

These guidelines help researchers assess whether their recombinant protein preparations contain properly folded and functionally reconstituted holocytochrome f.

What are the key considerations for comparative genomic analysis of the petA gene across different Eucalyptus species?

Comparative genomic analysis of the petA gene across different Eucalyptus species requires attention to several key factors:

  • Sequence conservation and variation:

    • Identify conserved domains essential for function versus variable regions

    • Calculate sequence identity and similarity percentages

    • Examine selection pressure (dN/dS ratios) across different regions of the gene

  • Genomic context:

    • Analyze the gene's position within the chloroplast genome

    • Examine conservation of flanking regions and potential regulatory elements

    • Compare with the known chloroplast genome structure of Eucalyptus globulus (160,286 bp with an inverted repeat of 26,393 bp separated by large and small single copy regions)

  • Evolutionary analysis:

    • Construct phylogenetic trees based on petA sequences

    • Compare with phylogenies based on other chloroplast genes

    • Identify potential horizontal gene transfer or recombination events

  • Structural implications:

    • Map sequence variations onto predicted protein structures

    • Assess whether variations occur in functionally important regions

    • Predict effects on protein stability and function

  • Expression pattern differences:

    • Compare promoter regions and potential regulatory elements

    • Analyze RNA-seq data if available to identify expression differences

    • Consider correlation with ecological or physiological adaptations

The chloroplast genome of Eucalyptus globulus has been fully sequenced and analyzed, providing a valuable reference point for comparative studies . When comparing with other plant species like Populus trichocarpa, researchers should note that while the genomes are largely co-linear, there are specific differences in gene content and arrangement that may reflect evolutionary adaptations.

How can researchers effectively troubleshoot expression and purification issues with recombinant Apocytochrome f?

Troubleshooting expression and purification issues with recombinant Apocytochrome f requires systematic analysis and methodical problem-solving:

IssuePotential CausesTroubleshooting Approaches
Low expression yieldCodon bias, protein toxicity, mRNA stabilityTry different E. coli strains, optimize codons, use lower induction temperature, test different promoters
Protein insolubilityImproper folding, inclusion body formationExpress at lower temperature (16°C), add solubility tags (SUMO, MBP), use mild detergents, optimize buffer conditions
Degradation during purificationProtease activity, intrinsic instabilityAdd protease inhibitors, use shorter purification protocols, maintain cold temperature throughout, optimize buffer pH and ionic strength
Poor heme incorporationInsufficient heme availability, improper protein foldingAdd ALA or hemin to culture, co-express heme lyase, attempt in vitro reconstitution with controlled conditions
Aggregation after purificationHydrophobic interactions, disulfide formationAdd stabilizing agents (glycerol, trehalose), maintain reducing conditions, optimize protein concentration and storage buffers
Low activityImproper folding, heme oxidation, incorrect post-translational modificationsCheck spectroscopic properties, test different reconstitution methods, verify protein integrity by mass spectrometry

Based on the available information about the recombinant Eucalyptus globulus Apocytochrome f:

  • The protein should be stored in Tris/PBS-based buffer with trehalose (6%), at pH 8.0 .

  • Addition of glycerol (final concentration 5-50%) is recommended for long-term storage at -20°C/-80°C .

  • Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided .

  • Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

These specific recommendations can help maintain protein stability and functionality throughout the purification and storage process.

How does the chloroplast genome context of the petA gene in Eucalyptus globulus compare to other plant species?

The chloroplast genome context of the petA gene in Eucalyptus globulus shows both conservation and divergence when compared to other plant species:

SpeciesChloroplast Genome SizepetA LocationNotable FeaturesEvolutionary Implications
Eucalyptus globulus160,286 bpWithin large single copy regionPart of 128 genes (112 individual + 16 duplicated in IR)Typical angiosperm arrangement
Populus trichocarpa~157,000 bpWithin large single copy regionLacks rps16 and rpl32 genes; IR expanded to include rps19Recent evolutionary divergence in gene content
Nicotiana tabacum~156,000 bpWithin large single copy regionSimilar gene order to E. globulusConserved arrangement in dicots
Pinus species~120,000 bpDifferent arrangementVery small IR, additional tRNAs and photosynthetic genes, lack functional ndh genesSignificant gymnosperm vs. angiosperm differences

The complete chloroplast genome of Eucalyptus globulus reveals a typical angiosperm arrangement with:

  • An inverted repeat (IR) of 26,393 bp

  • A large single copy (LSC) region of 89,012 bp

  • A small single copy region of 18,488 bp

  • A total of 128 genes coding for 30 transfer RNAs, 4 ribosomal RNAs, and 78 proteins

When compared with the chloroplast genome of another hardwood tree species, Populus trichocarpa, the E. globulus genome is essentially co-linear, except that Populus lacks rps16 and rpl32, and the IR has expanded in Populus to include rps19 (which is part of the LSC in E. globulus) .

Interestingly, there does not appear to be any correlation between plant habit (tree vs. non-tree) and chloroplast genome composition and arrangement. The differences between hardwood and softwood chloroplasts essentially reflect broader angiosperm versus gymnosperm differences .

What insights can functional studies of recombinant Apocytochrome f provide for understanding photosynthetic efficiency in Eucalyptus?

Functional studies of recombinant Apocytochrome f can provide valuable insights into photosynthetic efficiency in Eucalyptus through several research avenues:

These studies are particularly relevant considering that Eucalyptus globulus is one of the most economically important species for hardwood forestry plantations in temperate regions of the world . Enhancing photosynthetic efficiency could have significant implications for biomass production, carbon sequestration, and adaptation to climate change.

How can knowledge of Apocytochrome f structure and function contribute to biotechnological applications in Eucalyptus?

Knowledge of Apocytochrome f structure and function can contribute to several biotechnological applications in Eucalyptus:

  • Genetic engineering for enhanced photosynthesis:

    • Targeted modifications to improve electron transport efficiency

    • Engineering variants with altered redox potentials for optimized electron flow

    • Creation of synthetic electron transport components with novel properties

  • Stress tolerance improvement:

    • Development of variants with enhanced stability under temperature extremes

    • Engineering forms resistant to photoinhibition under high light

    • Creating plants with improved recovery from stress conditions

  • Biomass optimization:

    • Enhancing carbon fixation rates through optimized electron transport

    • Improving energy conversion efficiency for increased growth rates

    • Balancing photosynthetic efficiency with water use efficiency

  • Biofuel and biomaterial applications:

    • Engineering electron transport to direct energy toward specific metabolic pathways

    • Optimizing carbon partitioning for enhanced production of desired compounds

    • Creating specialized eucalyptus varieties for specific industrial applications

  • Biosensor development:

    • Using recombinant cytochrome f as a component in biosensors for environmental monitoring

    • Developing protein-based devices for measuring electron transport efficiency

    • Creating diagnostic tools for assessing plant stress responses

Recent advances in genetic engineering of eucalyptus, such as the development of insect-resistant varieties expressing Cry pesticidal proteins , demonstrate the feasibility of genetic modification approaches. Similar techniques could potentially be applied to modify photosynthetic components like cytochrome f for improved performance.

While such applications would require careful consideration of ecological and regulatory concerns, they represent promising avenues for enhancing the sustainability and productivity of eucalyptus plantations, which currently cover approximately 7.5 million hectares in Brazil alone and serve as the primary woody species cultivated for commercial purposes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.